Align histidine transport ATP-binding protein hisP (characterized)
to candidate CCNA_02006 CCNA_02006 lipoprotein releasing system ATP-binding protein lolD
Query= CharProtDB::CH_003210 (257 letters) >FitnessBrowser__Caulo:CCNA_02006 Length = 228 Score = 130 bits (326), Expect = 3e-35 Identities = 84/236 (35%), Positives = 130/236 (55%), Gaps = 17/236 (7%) Query: 1 MSENKLNVIDLHKRY----GEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEK 56 MS+ L + L + Y G+ VL+GV L G+V+ +IG SGSGKS+ L LE+ Sbjct: 1 MSDPVLALRGLERVYKTEAGDLPVLRGVDLDVYPGEVVGLIGPSGSGKSSLLHSAGLLER 60 Query: 57 PSEGSIVVNGQTINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEA 116 P G + + G+ + K++++ + R+ + V+Q +L + LENV Sbjct: 61 PDAGLVALEGRDCS---------KLSERARTRIRLGTVGFVYQFHHLLPEFSALENVA-M 110 Query: 117 PIQVLGLSKQEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLF 176 P+ + G S++EA RA + L +G+ R + P +SGG+QQRV+IARALA P++LL Sbjct: 111 PLTIAGKSRREAEARARELLESLGLGHRLNHQ-PAQMSGGEQQRVAIARALANRPKLLLA 169 Query: 177 DEPTSALDPELVGEVLRIMQQLA-EEGKTMVVVTHEMGFARHVSTHVIFLHQGKIE 231 DEPT LDP V + + Q+ E+G V+ TH M AR++ V+ L G +E Sbjct: 170 DEPTGNLDPATSTAVFQALYQVCREQGVAAVIATHNMELARYMD-RVVALKDGHLE 224 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 228 Length adjustment: 23 Effective length of query: 234 Effective length of database: 205 Effective search space: 47970 Effective search space used: 47970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory