Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate CCNA_01009 CCNA_01009 N-formylglutamate deformylase
Query= reanno::Korea:Ga0059261_3962 (264 letters) >FitnessBrowser__Caulo:CCNA_01009 Length = 271 Score = 335 bits (859), Expect = 6e-97 Identities = 168/265 (63%), Positives = 199/265 (75%), Gaps = 7/265 (2%) Query: 2 IHVEQGSAPLIVSVPHAGTVIPADIQG-LVSPELARYDADLYVDHLYAFARGLDATIVRT 60 + V +GSAPLI+S+PH GT IP DI+ L SP LAR DAD +V+ LYAFA L AT+VRT Sbjct: 5 LQVVRGSAPLIISLPHTGTDIPPDIESQLASPWLARKDADWWVEQLYAFAENLGATLVRT 64 Query: 61 TVSRTVIDVNRDPSGQTLYPGQFTTGLCPIQTFDGTPLYEPGALPDAHEIERRRAEWFDP 120 +SRTVIDVNRDPSG +LYPGQ TT LCP TFDG PLY G PDA EI+ RR +F+P Sbjct: 65 AISRTVIDVNRDPSGASLYPGQATTELCPTTTFDGEPLYRDGG-PDAAEIDHRRTTYFEP 123 Query: 121 YHTALAIQIERLRAIHPAIVVYDAHSIRSVVPKLFDGELPNFNIGTNDGTSCAPALTQAV 180 YH AL +IERLRA+HP +V+Y+AHSIRS VP+LF+GELP FN+GTN G SCA ALT AV Sbjct: 124 YHAALRSEIERLRAVHPTVVLYEAHSIRSRVPRLFEGELPQFNLGTNSGQSCADALTVAV 183 Query: 181 EAICDASPYSRVTNGRFKGGWITRHYARPAGGVHSIQMELAMRTYLVE-----TPAHWPP 235 EA CDAS SRVTNGRFKGGW TRHY +PA GVH+IQMELA R Y+ + TP WP Sbjct: 184 EAACDASGLSRVTNGRFKGGWTTRHYGQPATGVHAIQMELACRGYMDDPAEPPTPDTWPT 243 Query: 236 PWHEETAQACQSVLRPILSAAIDFA 260 P+H A+ ++VL +L A +DFA Sbjct: 244 PFHAARAEPLRAVLEEVLGACLDFA 268 Lambda K H 0.321 0.136 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 271 Length adjustment: 25 Effective length of query: 239 Effective length of database: 246 Effective search space: 58794 Effective search space used: 58794 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate CCNA_01009 CCNA_01009 (N-formylglutamate deformylase)
to HMM TIGR02017 (hutG: N-formylglutamate deformylase (EC 3.5.1.68))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02017.hmm # target sequence database: /tmp/gapView.18981.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02017 [M=263] Accession: TIGR02017 Description: hutG_amidohyd: N-formylglutamate deformylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-140 451.3 0.0 6.1e-140 451.1 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_01009 CCNA_01009 N-formylglutamate def Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_01009 CCNA_01009 N-formylglutamate deformylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 451.1 0.0 6.1e-140 6.1e-140 1 262 [. 3 269 .. 3 270 .. 0.99 Alignments for each domain: == domain 1 score: 451.1 bits; conditional E-value: 6.1e-140 TIGR02017 1 dalevqrGkaPllislPhtGtdltdavesrlvsaakalkdtdWhieklydfardlGatvvraaisrlvidvnr 73 d+l+v rG+aPl+islPhtGtd+++++es+l+s+++a+kd+dW++e+ly+fa++lGat+vr+aisr+vidvnr lcl|FitnessBrowser__Caulo:CCNA_01009 3 DWLQVVRGSAPLIISLPHTGTDIPPDIESQLASPWLARKDADWWVEQLYAFAENLGATLVRTAISRTVIDVNR 75 79*********************************************************************** PP TIGR02017 74 dpsgaslypgqattgliPettfdgeplykdGeaPseaeikkrltkyfkPyhaalraeierlralhgkivlyda 146 dpsgaslypgqatt+l+P+ttfdgeply+dG P++aei++r+t+yf+Pyhaalr+eierlra+h+++vly+a lcl|FitnessBrowser__Caulo:CCNA_01009 76 DPSGASLYPGQATTELCPTTTFDGEPLYRDG-GPDAAEIDHRRTTYFEPYHAALRSEIERLRAVHPTVVLYEA 147 *******************************.9**************************************** PP TIGR02017 147 hsirsviPrlfeGklPdfnlGtndgkscdpaladaveavcakakglssvlnGrfkGGyitrhygqPqngvhav 219 hsirs++PrlfeG+lP+fnlGtn+g+sc++al+ avea+c+ a+gls+v+nGrfkGG++trhygqP++gvha+ lcl|FitnessBrowser__Caulo:CCNA_01009 148 HSIRSRVPRLFEGELPQFNLGTNSGQSCADALTVAVEAACD-ASGLSRVTNGRFKGGWTTRHYGQPATGVHAI 219 *****************************************.******************************* PP TIGR02017 220 qlelaqrgylee.......etePvaydeakaealravlkellealldfae 262 q+ela+rgy+++ +t+P+++++a+ae+lravl+e+l a+ldfa+ lcl|FitnessBrowser__Caulo:CCNA_01009 220 QMELACRGYMDDpaepptpDTWPTPFHAARAEPLRAVLEEVLGACLDFAN 269 ************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (271 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.90 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory