Align ABC transporter for L-Histidine, permease component (characterized)
to candidate CCNA_02750 CCNA_02750 ABC transporter permease protein
Query= reanno::pseudo5_N2C3_1:AO356_09615 (283 letters) >FitnessBrowser__Caulo:CCNA_02750 Length = 224 Score = 78.2 bits (191), Expect = 2e-19 Identities = 61/198 (30%), Positives = 102/198 (51%), Gaps = 19/198 (9%) Query: 93 MQTLALMLVATLISVLIGIPLGIL-------SARSNRLRSVLMPLL-DIMQTMPSFVYLI 144 + TLA++ + +++V G+PLG++ NRL + + LL +I++++P + LI Sbjct: 21 LDTLAMLGGSMVLTVAGGLPLGVILFLTGKGQMLENRLANGALSLLVNILRSVPFVILLI 80 Query: 145 PVLMLF------GLGKVPAIFATVIYAAPPLIRLTDLGIRQVDGEVMEAINAFGANRWQQ 198 ++ L LG AI V AAP RL + +R+VD V+EA A GA R Q Sbjct: 81 VMIPLTVALVGTSLGVAGAIPPLVAGAAPFFARLVETALREVDKGVIEASFAMGAKRRQV 140 Query: 199 LFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGE-DVLVGIQTLNVGRGLEAG 257 + G LP ALP ++A T + +S +A ++GA GLG+ + G Q + Sbjct: 141 VLGALLPEALPGLVAAATVTAVALVSYTAMAGVVGAGGLGDLAIRFGYQRFQT----DVM 196 Query: 258 LAIVILAVVIDRITQAYG 275 + V+L +V+ ++ Q G Sbjct: 197 VVTVVLMLVLVQVLQMIG 214 Lambda K H 0.328 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 224 Length adjustment: 24 Effective length of query: 259 Effective length of database: 200 Effective search space: 51800 Effective search space used: 51800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory