Align 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate CCNA_01875 CCNA_01875 acyl-CoA dehydrogenase, short-chain specific
Query= reanno::psRCH2:GFF2397 (379 letters) >FitnessBrowser__Caulo:CCNA_01875 Length = 381 Score = 291 bits (746), Expect = 2e-83 Identities = 155/367 (42%), Positives = 220/367 (59%), Gaps = 1/367 (0%) Query: 8 NAIAEMARQFAQERLKPFAEQWSREHRYPAEAIGEMAALGFFGMLVPEQWGGSDTGYLAY 67 +A+ ++ ++F ERL+P S P I EM LG FG+ +PE +GG Sbjct: 8 SALIDVIQRFVAERLRPIEGLVSETDEVPGSIIEEMKQLGLFGLSIPESYGGLGLSLEEE 67 Query: 68 AMALEEIAAGDGACSTIMSVHNSVGCVPILRFGNEQQKSDFLTPLARGEQIGAFALTEPQ 127 A + A + + +G ++ FG+E QK+ +L +A GE I AFALTE + Sbjct: 68 ARVIVAFCHTAPAFRSTFGTNVGIGSQGLVMFGDEAQKARWLPSIASGETITAFALTEAE 127 Query: 128 AGSDASSLRTRARRDGDHYVLNGAKQFITSGKHAGTVIVFAVTDPDA-GKGGISAFIVPT 186 AGSD++S++TRA RDGDHYVLNG K++IT+ A V A TDP+ G G+SAF+VP Sbjct: 128 AGSDSASVQTRAVRDGDHYVLNGVKRYITNAGRANLFTVMARTDPNTKGGAGVSAFLVPA 187 Query: 187 DSPGYQVVRVEDKLGQHASDTCQIAFEDLRVPVANRLGEEGEGYRIALANLEGGRIGIAA 246 D PG V + E K+GQ + + FED+RVPV NRLG EGEG+ +A+ L+ GR+ I+A Sbjct: 188 DLPGLSVGKPEKKMGQQGAHIHDVVFEDVRVPVENRLGAEGEGFTVAMRVLDRGRVHISA 247 Query: 247 QAVGMARAAFEAARDYARDRETFGKPIIEHQAVAFRLADMATQIAVARQMVHHAAALREV 306 VG+A YA +R+ FG+PI Q + +AD T+ A+ +V A R+ Sbjct: 248 VCVGVAERLIADCVAYASERKQFGQPIASFQLIQAMIADSKTEALAAKALVFDTARKRDA 307 Query: 307 GRPALVEASMAKLFASEMAEKVCSAAIQTLGGYGYLADFPVERIYRDVRVCQIYEGTSDI 366 G +EA+ KLFASEM +V A+Q GG GY+AD+ +ER+YRDVR+ +IYEG S I Sbjct: 308 GANVTLEAAATKLFASEMVGRVADRAVQVFGGAGYVADYGIERLYRDVRIFRIYEGASQI 367 Query: 367 QRLVISR 373 Q+L+I+R Sbjct: 368 QQLIIAR 374 Lambda K H 0.320 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 381 Length adjustment: 30 Effective length of query: 349 Effective length of database: 351 Effective search space: 122499 Effective search space used: 122499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory