Align Enoyl-CoA hydratase AFT3-1; AF-toxin biosynthesis protein 3-1; EC 4.2.1.17 (characterized)
to candidate CCNA_00996 CCNA_00996 enoyl-CoA hydratase
Query= SwissProt::Q96VB3 (296 letters) >FitnessBrowser__Caulo:CCNA_00996 Length = 294 Score = 201 bits (511), Expect = 2e-56 Identities = 116/258 (44%), Positives = 154/258 (59%), Gaps = 15/258 (5%) Query: 23 DGIAVIVLARSQSRNALTLPMLTDMVQLLSAMDADDSVKCIVFTGEGPFFCSGVDLTEGF 82 DGIA I L R NA T M+ D++++ DADD+VK ++ TG G FC+G DL G Sbjct: 15 DGIATITLNRPDRMNAFTARMMKDLIEVFDVTDADDAVKVVIITGAGRAFCAGADLGGGG 74 Query: 83 G------------EIGKTRDTHRDAGGKLALAIHNCRKPTIAAINGTAVGVGITMTLPMS 130 E GK D +RD GG++ L +++ KP I AING AVGVG+TM LPM Sbjct: 75 ATFDRTSPQALEREEGKVGDIYRDGGGRVTLRMYDSLKPIIGAINGAAVGVGVTMQLPMD 134 Query: 131 IRIAAKTAKISFPFVRRGIVADAASSFYLPRLIGYGRALHLFTTGALYPAESGLLHGLFS 190 IR+A+ AK F F RRGI +AASS++LPRL+G AL TG ++PA L GL Sbjct: 135 IRLASTEAKFGFVFARRGINPEAASSWFLPRLVGLQTALEWCYTGRVFPASEALEKGLV- 193 Query: 191 ETVNAASSTLPRALEVARDIAVNASQVGVYLTRDLVYRSPRS--PEQAHLLESAALYTRY 248 +++A LP A +AR+IA N + V V LTR L++R + P +AH +S A+ +R Sbjct: 194 RSLHAPDELLPAARALAREIADNTAPVSVALTRQLLWRMAGADHPMEAHKADSRAIQSRG 253 Query: 249 QSRDFEEGVQSFLEKRKP 266 S D +EGV SFLEKR P Sbjct: 254 SSGDAKEGVTSFLEKRAP 271 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 294 Length adjustment: 26 Effective length of query: 270 Effective length of database: 268 Effective search space: 72360 Effective search space used: 72360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory