Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate CCNA_01927 CCNA_01927 enoyl-CoA hydratase
Query= curated2:P24162 (257 letters) >FitnessBrowser__Caulo:CCNA_01927 Length = 267 Score = 192 bits (488), Expect = 6e-54 Identities = 112/268 (41%), Positives = 151/268 (56%), Gaps = 12/268 (4%) Query: 1 MSYHTIRYEISEGLAVITLDRPEVMNALNAAMRHELTAA---LHRARGEARAIVLTGSGR 57 M Y IR +G+A +TL P +NA + + EL A + + EARA++LTG GR Sbjct: 1 MDYQKIRVSTQDGVATVTLADPTTLNAASPEVARELHHAFSSIAAGKIEARAVILTGEGR 60 Query: 58 AFCSGQDLGDGAAEGLNLE--------TVLREEYEPLLQAIYSCPLPVLAAVNGAAAGAG 109 FCSG +L G A G + + L Y PL+ + PLP++ AVNG AAG G Sbjct: 61 GFCSGANLSGGGAAGREADVDGKPDAGSALETVYNPLMTLLRDFPLPIVTAVNGPAAGVG 120 Query: 110 ANLALAADVVIAAQSAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEE 169 ++AL D+++AA+SA F+QAF RIGL+PD G T+ LPR +G ARAM M L +KI A Sbjct: 121 CSIALMGDLIVAAESAYFLQAFRRIGLVPDGGSTYLLPRLIGKARAMEMMLLGDKIPAAT 180 Query: 170 AARMGLIWEAVPDVDFEHHWRARAAHLARGPSAAFAAVKKAFHAGLSNPLPAQLALEARL 229 A + GL+ VPD + A A LA+GP AA ++K L + QL E + Sbjct: 181 ALQWGLVNRCVPDAELMVTAHALALELAKGP-AALGVIRKLVWDSLDSDWTGQLHAERKA 239 Query: 230 QGELGQSADFREGVQAFLEKRPPHFTGR 257 Q G++ DF EGV AFL+KR F GR Sbjct: 240 QKIAGKTEDFIEGVTAFLQKRAAVFKGR 267 Lambda K H 0.321 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 267 Length adjustment: 25 Effective length of query: 232 Effective length of database: 242 Effective search space: 56144 Effective search space used: 56144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory