GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fadA in Caulobacter crescentus NA1000

Align 3-oxo-acyl CoA thiolase (EC 2.3.1.16) (characterized)
to candidate CCNA_00820 CCNA_00820 3-ketoacyl-CoA thiolase

Query= metacyc::G185E-7833-MONOMER
         (386 letters)



>lcl|FitnessBrowser__Caulo:CCNA_00820 CCNA_00820 3-ketoacyl-CoA
           thiolase
          Length = 390

 Score =  378 bits (970), Expect = e-109
 Identities = 199/394 (50%), Positives = 271/394 (68%), Gaps = 12/394 (3%)

Query: 1   MTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDDVIAGCVDAIG 60
           M EAY++ A RTA G++GG ++G HP DL       L+DR+  DPA ++DVI GCV  +G
Sbjct: 1   MGEAYIVAAARTAGGRKGGRVSGWHPADLAGEVLNALVDRSGADPALIEDVIMGCVGQVG 60

Query: 61  GQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAIMSGTADVIVAGGVQNMS 120
            QA NIAR + LA+  PE VP  +VDRQCGSSQQ+I F A  +MSG  D+++A GV++MS
Sbjct: 61  EQAINIARNAVLASKLPESVPATSVDRQCGSSQQSIHFAAATVMSGAMDIVIAAGVESMS 120

Query: 121 QIP--ISSAMTVGEQFGFTSPTNESKQWLHRYGDQEISQFRGSELIAEKWNLSREEMERY 178
           ++P  +SSA+     FG    T +S +   RY   + SQF G+E++A+K++LSRE+++ +
Sbjct: 121 RVPMGLSSALPYKNGFG----TYKSPRMEERYPGIQFSQFAGAEMLAKKYDLSREQLDAF 176

Query: 179 SLTSHERAFAAIRAGHFENEIITVETESGPFRV-----DEGPR-ESSLEKMAGLQPLVEG 232
           +L SH+RA AA + G F  EI+ ++       V     DEG R ++++E + G++ L E 
Sbjct: 177 ALASHQRAMAATKGGKFAAEIVPIKVTLPDGSVETHDADEGIRWDATMESIGGVKLLSED 236

Query: 233 GRLTAAMASQISDGASAVLLASERAVKDHGLRPRARIHHISARAADPVFMLTGPIPATRY 292
           GRLTAA +SQI DGA+ V++ +ER +K  G+ P ARIHH++    DPV ML  PIPAT+ 
Sbjct: 237 GRLTAATSSQICDGAAGVMIVNERGLKALGVAPLARIHHMTVIGHDPVIMLEAPIPATQK 296

Query: 293 ALDKTGLAIDDIDTVEINEAFAPVVMAWLKEIKADPAKVNPNGGAIALGHPLGATGAKLF 352
           AL++ G+ IDDID  E+NEAFA V  AWL+    DP K+N NGGAIALGHPLG +GAKL 
Sbjct: 297 ALERAGMKIDDIDLYEVNEAFASVPTAWLQVTGGDPDKLNVNGGAIALGHPLGGSGAKLM 356

Query: 353 TTMLGELERIGGRYGLQTMCEGGGTANVTIIERL 386
           TT++  L+  G RYGLQTMCEGGG ANVTI+ERL
Sbjct: 357 TTLVHALKDRGARYGLQTMCEGGGLANVTIVERL 390


Lambda     K      H
   0.317    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 452
Number of extensions: 18
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 386
Length of database: 390
Length adjustment: 30
Effective length of query: 356
Effective length of database: 360
Effective search space:   128160
Effective search space used:   128160
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory