Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate CCNA_00090 CCNA_00090 UDP-glucose 4-epimerase
Query= curated2:Q59745 (327 letters) >FitnessBrowser__Caulo:CCNA_00090 Length = 327 Score = 425 bits (1092), Expect = e-124 Identities = 202/318 (63%), Positives = 245/318 (77%) Query: 4 ETVLVVGGAGYIGSHTCLDLANKGYRPVVFDNFSNGHREFVRWGPAEEGDIRDRARLDEV 63 +TVLV GGAGY+GSH CL LA G+RPVVFD+ SNGHRE V+WGP E GDIRD ARLD V Sbjct: 2 QTVLVTGGAGYVGSHCCLALAEAGFRPVVFDDLSNGHREHVQWGPLEVGDIRDAARLDAV 61 Query: 64 LAKHKPAAILHFAALIEVGESVKDPVSFYENNVIGTLTLLSAAQAAGINAFVFSSTCATY 123 A + P A+LHFAA IEVGESVK+P +F++ NV GT+TL+ AA+ AG+ VFSSTCAT+ Sbjct: 62 FAAYAPVAVLHFAARIEVGESVKNPGAFFDTNVGGTITLIEAARRAGVKVVVFSSTCATF 121 Query: 124 GLPQSVPLDETHRQVPINPYGRTKYIVEQALADYDQYGSLRSVVLRYFNAAGADFEGRIG 183 G P +P+ ETH Q P+NPYGR+K +VEQALADYD+Y L+S V+RYFNAAGAD +GRIG Sbjct: 122 GDPVDLPMKETHPQAPLNPYGRSKLMVEQALADYDRYVGLKSAVMRYFNAAGADPQGRIG 181 Query: 184 EWHQPETHAIPLAIDAALGRRQGFKVFGSDYETRDGTCVRDYIHVLDLADAHVRAVEYLL 243 EWH+PETHA+PLAI ALG+R F +FG DY+TRDGT VRDY+HVLDLADAHV A++ LL Sbjct: 182 EWHEPETHAVPLAIQVALGQRPRFTIFGDDYDTRDGTAVRDYVHVLDLADAHVAALKRLL 241 Query: 244 KGGDSVALNLGTGTGTTVKELLGAIEEVSNRPFPVEYIGRREGDSHTLVANNDKARDVLG 303 GG S NLGTGTGTTV+EL+ + +V+ P PVE RR GD+ LV ++ KAR LG Sbjct: 242 VGGSSETYNLGTGTGTTVRELVDGVGKVAGAPLPVEIASRRPGDAPVLVGDHAKARAELG 301 Query: 304 WVPQYDLSEIIRSAWDWH 321 W L EI+ +AW WH Sbjct: 302 WKASRSLDEILSTAWRWH 319 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 327 Length adjustment: 28 Effective length of query: 299 Effective length of database: 299 Effective search space: 89401 Effective search space used: 89401 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate CCNA_00090 CCNA_00090 (UDP-glucose 4-epimerase)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.28767.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-125 404.4 0.0 1.7e-125 404.2 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_00090 CCNA_00090 UDP-glucose 4-epimera Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_00090 CCNA_00090 UDP-glucose 4-epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 404.2 0.0 1.7e-125 1.7e-125 2 328 .. 4 322 .. 3 326 .. 0.99 Alignments for each domain: == domain 1 score: 404.2 bits; conditional E-value: 1.7e-125 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleeekidav 74 +LvtGgaGy+Gsh + +l e+g++ vv+D+ls+g++e+++++ l gd++d+++l+av+++ ++ av lcl|FitnessBrowser__Caulo:CCNA_00090 4 VLVTGGAGYVGSHCCLALAEAGFRPVVFDDLSNGHREHVQWGP------LEVGDIRDAARLDAVFAAYAPVAV 70 8******************************************......999********************* PP TIGR01179 75 iHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEesplnpinpYGr 147 +Hfaa+i+vgEsvk+P +++ nv +t++L+ea ++agvk ++Fss++a++g++ ++p++E++p++p npYGr lcl|FitnessBrowser__Caulo:CCNA_00090 71 LHFAARIEVGESVKNPGAFFDTNVGGTITLIEAARRAGVKVVVFSSTCATFGDPVDLPMKETHPQAPLNPYGR 143 ************************************************************************* PP TIGR01179 148 sklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkrekleifGtdyptk 220 sklmvE+ l d+ + +lk +++RYFn+aGAd++g+iGe ++++th ++l+++va+g+r++++ifG+dy+t+ lcl|FitnessBrowser__Caulo:CCNA_00090 144 SKLMVEQALADYDRY-VGLKSAVMRYFNAAGADPQGRIGEWHEPETHAVPLAIQVALGQRPRFTIFGDDYDTR 215 ************999.********************************************************* PP TIGR01179 221 DGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsgkdikveladrRaGDpas 293 DGt+vRDy+Hv Dla+aH+aal+ l gg se+ynlG+g+g v+e+++ v kv+g++++ve+a rR+GD ++ lcl|FitnessBrowser__Caulo:CCNA_00090 216 DGTAVRDYVHVLDLADAHVAALKRLLVGGSSETYNLGTGTGTTVRELVDGVGKVAGAPLPVEIASRRPGDAPV 288 ************************************************************************* PP TIGR01179 294 lvadaskikrelgwkpkyddLeeiiksawdWekkl 328 lv+d +k+++elgwk+++ L+ei+++aw+W++ + lcl|FitnessBrowser__Caulo:CCNA_00090 289 LVGDHAKARAELGWKASRS-LDEILSTAWRWHRGR 322 ******************9.***********9865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (327 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.41 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory