Align L-arabinonolactonase (characterized, see rationale)
to candidate CCNA_01882 CCNA_01882 SMP-30/gluconolaconase/LRE-like protein
Query= uniprot:A0A1I2AUG6 (300 letters) >FitnessBrowser__Caulo:CCNA_01882 Length = 293 Score = 149 bits (375), Expect = 1e-40 Identities = 105/282 (37%), Positives = 136/282 (48%), Gaps = 12/282 (4%) Query: 13 LGEGILWCEREQALYWTDIQAATLWRHRPADGATRSWEMPERLGCLALCEADGWLLLGLA 72 LGE LW LYW D A +WR+ P RS P+ +G + L G L+ GLA Sbjct: 15 LGESPLWDADAGVLYWVDSMAPAIWRYDPFTSEQRSIPAPKPIGSVVLGRP-GELIAGLA 73 Query: 73 TRLAFFRPEDDLLLPLVSVEPDLPT-RLNDGACDRQGRFVFGTLHEPAAGETRQPIGAFY 131 + + + P+ + P R NDG DRQGRFV GT+ A IG Y Sbjct: 74 DGVYRVQLDTGAFTPIALPDTLAPIERFNDGKADRQGRFVTGTM---AMHNETGRIGKLY 130 Query: 132 RLNADLTLERLNLPGIGISNSVAFSPDGRTMYFCDSPSRVIQCCDYGDRCG---EPRVFA 188 R +A E L I I+NS FSP G T+YF DS ++ Y + G E R F Sbjct: 131 RFSAGGAWEVLPTEPIEIANSTCFSPSGDTLYFADSLRHMVWAFSYDPKTGAVGEKRDFF 190 Query: 189 RVDDERGEPDGSAVDAQGCLWNAQWGLGRVVRYAPDGRVDRIVEVPATQPTRPAFGDSPL 248 PDG+ VDA+G +W A +++R +PDGR+DR+VE PA + PAFG L Sbjct: 191 DTTGFNSAPDGATVDAEGHIWLALVQAQKLIRISPDGRLDRVVESPAPFCSCPAFGGEDL 250 Query: 249 DTLYITSARDGLSSAALATQ-PLAGALFAADA-GASGLPEPR 288 D LY+TS D S L T +G L A G G+ E R Sbjct: 251 DILYVTSISD--SGGRLKTDVDASGRLMAFHGLGVRGIAETR 290 Lambda K H 0.321 0.139 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 293 Length adjustment: 26 Effective length of query: 274 Effective length of database: 267 Effective search space: 73158 Effective search space used: 73158 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory