Align Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate CCNA_01875 CCNA_01875 acyl-CoA dehydrogenase, short-chain specific
Query= reanno::Phaeo:GFF1011 (386 letters) >FitnessBrowser__Caulo:CCNA_01875 Length = 381 Score = 270 bits (691), Expect = 4e-77 Identities = 142/375 (37%), Positives = 226/375 (60%), Gaps = 1/375 (0%) Query: 12 EDVNALRDMVHRWAQERVRPMAQEIDQKNEFPAELWQEMGELGLLGITVPEEFGGAGMSY 71 + ++AL D++ R+ ER+RP+ + + +E P + +EM +LGL G+++PE +GG G+S Sbjct: 5 DTLSALIDVIQRFVAERLRPIEGLVSETDEVPGSIIEEMKQLGLFGLSIPESYGGLGLSL 64 Query: 72 LAHTVAVEEIARASASVSLSYGAHSNLCVNQIKLNGNAEQKAKYLPRLVSGEHVGALAMS 131 + + + ++G + + + + G+ QKA++LP + SGE + A A++ Sbjct: 65 EEEARVIVAFCHTAPAFRSTFGTNVGIGSQGLVMFGDEAQKARWLPSIASGETITAFALT 124 Query: 132 EAGAGSDVVSMSLRAEKRNDHYRLNGNKYWITNGPDADTLVVYAKTDPDA-GSKGMTAFL 190 EA AGSD S+ RA + DHY LNG K +ITN A+ V A+TDP+ G G++AFL Sbjct: 125 EAEAGSDSASVQTRAVRDGDHYVLNGVKRYITNAGRANLFTVMARTDPNTKGGAGVSAFL 184 Query: 191 IEKEFKGFSTSQHFDKLGMRGSNTAELVFEDVEVPFENVLGEEGKGVRVLMSGLDYERVV 250 + + G S + K+G +G++ ++VFEDV VP EN LG EG+G V M LD RV Sbjct: 185 VPADLPGLSVGKPEKKMGQQGAHIHDVVFEDVRVPVENRLGAEGEGFTVAMRVLDRGRVH 244 Query: 251 LAGIGTGIMAACMDEMMPYMKERKQFGQPIGNFQLMQGKIADMYTAMNTARAYVYEVAKA 310 ++ + G+ + + + Y ERKQFGQPI +FQL+Q IAD T A+A V++ A+ Sbjct: 245 ISAVCVGVAERLIADCVAYASERKQFGQPIASFQLIQAMIADSKTEALAAKALVFDTARK 304 Query: 311 CDKGTVTRQDAAACCLYASEVAMTQAHQAVQAFGGAGYLSDNPVGRIFRDAKLMEIGAGT 370 D G +AAA L+ASE+ A +AVQ FGGAGY++D + R++RD ++ I G Sbjct: 305 RDAGANVTLEAAATKLFASEMVGRVADRAVQVFGGAGYVADYGIERLYRDVRIFRIYEGA 364 Query: 371 SEIRRMLIGRELMSQ 385 S+I++++I RE + + Sbjct: 365 SQIQQLIIARETLKR 379 Lambda K H 0.318 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 381 Length adjustment: 30 Effective length of query: 356 Effective length of database: 351 Effective search space: 124956 Effective search space used: 124956 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory