GapMind for catabolism of small carbon sources

 

Aligments for a candidate for liuB in Caulobacter crescentus NA1000

Align Methylcrotonoyl-CoA carboxylase (EC 6.4.1.4) (characterized)
to candidate CCNA_02250 CCNA_02250 methylcrotonyl-CoA carboxylase biotin-containing subunit

Query= reanno::Smeli:SM_b21124
         (662 letters)



>lcl|FitnessBrowser__Caulo:CCNA_02250 CCNA_02250 methylcrotonyl-CoA
           carboxylase biotin-containing subunit
          Length = 654

 Score =  637 bits (1643), Expect = 0.0
 Identities = 353/666 (53%), Positives = 436/666 (65%), Gaps = 27/666 (4%)

Query: 1   MFSKLLIANRGEIACRIIRTARRLGIRTVAVYSDADGDALHVALADEAIRIGGAPAAESY 60
           M S +LIANRGEIA RIIRTAR LG+RT+AVYS+AD +A  V  AD AI IG APA ESY
Sbjct: 1   MLSSVLIANRGEIARRIIRTARELGVRTIAVYSEADANAPFVMEADAAILIGPAPAKESY 60

Query: 61  LASAPIVQAARSVGAQAIHPGYGFLSENADFAEAVAEAGMIFVGPPPAAIRAMGLKDAAK 120
           L    I+ AAR +GA+AIHPGYGFLSENA+FA++V +AG++++GPPP+AIRAMGLKDAAK
Sbjct: 61  LDPRKILAAARQMGAEAIHPGYGFLSENAEFAQSVIDAGLVWIGPPPSAIRAMGLKDAAK 120

Query: 121 ALMERSGVPVVPGYHGEEQDASFLADRAREIGYPVLIKARAGGGGKGMRRVERQEDFGPA 180
           A+M ++GVP  PGY GE+Q    L   A +IGYPVLIKA AGGGGKGMR+VER EDF  A
Sbjct: 121 AVMIKAGVPTTPGYLGEDQSVERLTVEAAKIGYPVLIKAVAGGGGKGMRKVERAEDFEAA 180

Query: 181 LEAARREAESAFGDGSVLLERYLTKPRHIEMQVFGDRHGNIVHLFERDCSLQRRHQKVIE 240
           L + RREA +AFGD  VLLE+Y+T+PRHIE+QVFGD HGN+VHLFERDCSLQRRHQKVIE
Sbjct: 181 LGSCRREASAAFGDDRVLLEKYVTRPRHIEVQVFGDSHGNVVHLFERDCSLQRRHQKVIE 240

Query: 241 EAPAPGMTAEVRRAMGDAAVRAAQAIGYVGAGTVEFIADVTNGLWPDHFYFMEMNTRLQV 300
           EAPAPGM    R A+  AAV+AAQA+ YVGAGTVEFIAD + GL  D  +FMEMNTRLQV
Sbjct: 241 EAPAPGMDEATREAVCAAAVKAAQAVNYVGAGTVEFIADASEGLRADRIWFMEMNTRLQV 300

Query: 301 EHPVTEAITGIDLVEWQLRVASGEPLPKKQADISMNGWAFEARLYAEDPARGFLPATGRL 360
           EHPVTE +TG DLVEWQLRVASGEPLP +Q +I+++GWA EARLYAE+PA GFLP+TG+L
Sbjct: 301 EHPVTEMVTGQDLVEWQLRVASGEPLPLEQDEITLDGWAMEARLYAENPATGFLPSTGKL 360

Query: 361 TELSFPEGTSRVDSGVRQGDTITPYYDPLIAKLIVHGQNRSAALGRLQDALKECRIGGTV 420
                PEG  RVDS V +G  +TP+YDP+IAKLI HG +R  A  RL +A     +    
Sbjct: 361 KHFRLPEGDVRVDSAVEEGGEVTPFYDPMIAKLIAHGADREDAAQRLAEACALVEVWPVK 420

Query: 421 TNRDFLIRLTEEHDFRSGHPDTGLIDREIERLTAPVAPGDEALALAAIFSTGALDPNRST 480
           TN  FL +     DF  G  DTG I+  ++ LT      + A+A         L+     
Sbjct: 421 TNAAFLAKCASHPDFVDGAVDTGFIEARLDELTERAFSDEPAMAAIGWRLDSFLEAEARR 480

Query: 481 DPW----SSLGSWQIWGDAHRMVVIEHADVRAT---VTLASRGRDQFA---VRAGASTLP 530
           DPW    S L  +++      M +    D +AT   V L   G + ++     A  ST  
Sbjct: 481 DPWEGAPSKLLGFRMNAPRASMHLPMSTDGKATPLRVALIGGGTEDWSWDIRHADGST-- 538

Query: 531 VLVLDRFEGGARLEVAGQKRLIRFSRDREALTLFHGGRNLVFHVPDGLTGGQSSEIADDE 590
                 F+   RL     K  I+         +F GG    F     + G      +D  
Sbjct: 539 ------FDEVTRLPTTYGKGPIQ---------VFEGGDVQEFDFVAKIGGAGEGGASDGA 583

Query: 591 LVAPMPGLVKLVRVGAGDAVTKGQALVVMEAMKMELTLSASREGTIANVHVAEGAQVSEG 650
           +++PMPG +  V V AG  V+KGQ L+ +EAMKME  ++A  +G +A +    G QVSEG
Sbjct: 584 ILSPMPGKIVSVSVSAGQTVSKGQTLLTLEAMKMEHAMAAPFDGVVAELSAVAGGQVSEG 643

Query: 651 TVLVTL 656
            VL  L
Sbjct: 644 VVLARL 649


Lambda     K      H
   0.319    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1214
Number of extensions: 47
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 2
Length of query: 662
Length of database: 654
Length adjustment: 38
Effective length of query: 624
Effective length of database: 616
Effective search space:   384384
Effective search space used:   384384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory