Align acetyl-CoA:acetyl-CoA C-acetyltransferase / acetyl-CoA:propanoyl-CoA 2-C-acetyltransferase (EC 2.3.1.9; EC 2.3.1.16) (characterized)
to candidate CCNA_00938 CCNA_00938 acetyl-CoA acetyltransferase
Query= reanno::pseudo3_N2E3:AO353_25685 (397 letters) >FitnessBrowser__Caulo:CCNA_00938 Length = 395 Score = 476 bits (1224), Expect = e-139 Identities = 240/389 (61%), Positives = 300/389 (77%) Query: 6 DPIVIVSAVRTPMGGFQGELKSLSAPQLGAAAIRAAVERAGVAADAVEEVLFGCVLSAGL 65 DP+VIV+ RTPMGGFQG L + A LGA A++AA+ERAGVA D VE+++ GCVL AGL Sbjct: 5 DPVVIVAYARTPMGGFQGALGGVKATDLGATAVKAAIERAGVAGDKVEQIIMGCVLPAGL 64 Query: 66 GQAPARQAALGAGLDKSTRCTTLNKMCGSGMEAAILAHDMLLAGSADVVVAGGMESMSNA 125 GQAPARQAALGAGL S TT+NKMCGSGM+AAI+AHD L AGS DVVVAGGMESM+ A Sbjct: 65 GQAPARQAALGAGLPLSVEATTVNKMCGSGMQAAIMAHDALAAGSVDVVVAGGMESMTGA 124 Query: 126 PYLLDRARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAEANGFTREAQDEFAI 185 PYL+ + R+G R+GH ++ D M+LDGLEDAY G+LMG FAED A+ FTREA D++A Sbjct: 125 PYLMSKHRAGARIGHDQMWDSMYLDGLEDAYTPGKLMGAFAEDSAQTYQFTREAMDDYAT 184 Query: 186 ASTTRAQQAIKDGSFNAEIVPLQVIVGKEQKLITDDEQPPKAKLDKIASLKPAFRDGGTV 245 +A+ A++ G+F AEI P+ V+ K +++ DEQP KA KI +L+PAF G V Sbjct: 185 RGLMKAKAAVESGAFKAEITPVSVVTRKGTEVVDTDEQPGKADPAKIPTLRPAFSRDGGV 244 Query: 246 TAANSSSISDGAAALLLMRRSEAEKRGLKPLAVIHGHAAFADTPGLFPVAPVGAIKKLLK 305 TAANSSSISDGAAAL++ R S A+ GL LA + HAA A PGLF APV A++K LK Sbjct: 245 TAANSSSISDGAAALVMTRESVAKALGLPILAKVVSHAAHAHEPGLFTTAPVPAMQKALK 304 Query: 306 KTGWSLDEVELFEVNEAFAVVSLVTMTKLEIPHSKVNVHGGACALGHPIGASGARILVTL 365 K GWS+ +V+LFEVNEAFAVV+++ +L IP K+NV+GGACALGHPIGASGARIL TL Sbjct: 305 KAGWSVADVDLFEVNEAFAVVAMIAQKELGIPDDKLNVNGGACALGHPIGASGARILCTL 364 Query: 366 LSALRQKGLKRGVAAICIGGGEATAMAVE 394 ++AL+ +G K+G+A++CIGGGEATAMA+E Sbjct: 365 INALQSRGGKKGLASLCIGGGEATAMAIE 393 Lambda K H 0.318 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 395 Length adjustment: 31 Effective length of query: 366 Effective length of database: 364 Effective search space: 133224 Effective search space used: 133224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory