Align butyryl-CoA dehydrogenase; EC 1.3.99.2 (characterized)
to candidate CCNA_02254 CCNA_02254 isovaleryl-CoA dehydrogenase
Query= CharProtDB::CH_091785 (379 letters) >FitnessBrowser__Caulo:CCNA_02254 Length = 386 Score = 298 bits (762), Expect = 2e-85 Identities = 158/377 (41%), Positives = 234/377 (62%), Gaps = 2/377 (0%) Query: 1 MDFNLTREQELVRQMVREFAENEVKPIAAEIDETERFPMENVKKMGQYGMMGIPFSKEYG 60 MDF L + +R+ FA +++ PIAA+IDET FP E MG G+ GI +E+G Sbjct: 9 MDFALGETADAIRETTARFAADKIAPIAAKIDETNSFPRELWVPMGDLGLHGITVEEEFG 68 Query: 61 GAGGDVLSYIIAVEELSKVCGTTGVILSAHTSLCASLINEHGTEEQKQKYLVPLAKGEKI 120 G G L +++A+EE+S+ + G+ AH++LC + I T EQK +YL L GE + Sbjct: 69 GLGLGYLEHVVAMEEVSRASASVGLSYGAHSNLCVNQIRRWATPEQKARYLPKLISGEHV 128 Query: 121 GAYGLTEPNAGTDSGAQQTVAVLEGDHYVINGSKIFITNGGVADTFVIFAMTDRTKGTKG 180 G+ ++E AG+D + + A GD Y++NG+K +ITN ADT V++A T +G++G Sbjct: 129 GSLAMSEAGAGSDVVSMKLRAEQVGDRYILNGTKFWITNAPHADTLVVYAKTG--EGSRG 186 Query: 181 ISAFIIEKGFKGFSIGKVEQKLGIRASSTTELVFEDMIVPVENMIGKEGKGFPIAMKTLD 240 I+AFI+EKG KGFS+ K K+G+R S T ELVFED +P EN++G G G + M LD Sbjct: 187 ITAFIVEKGMKGFSVSKKLDKMGMRGSDTAELVFEDCEIPEENVMGPVGGGVGVLMSGLD 246 Query: 241 GGRIGIAAQALGIAEGAFNEARAYMKERKQFGRSLDKFQGLAWMMADMDVAIESARYLVY 300 R +AA LGI + + Y+++RKQFG+ + FQ + +ADM VA+ SAR VY Sbjct: 247 YERAVLAAGPLGIMQACLDVVLPYVRDRKQFGQPIGSFQLMQGKIADMYVALNSARAYVY 306 Query: 301 KAAYLKQAGLPYTVDAARAKLHAANVAMDVTTKAVQLFGGYGYTKDYPVERMMRDAKITE 360 A AG DAA A L A+ A+ V+ +A+Q GG GYTK++PVER++RDAK+ + Sbjct: 307 AVAKACDAGKTTRFDAAGAILMASENAVKVSLEAIQALGGAGYTKEWPVERLLRDAKLYD 366 Query: 361 IYEGTSEVQKLVISGKI 377 I GT+E+++ +I ++ Sbjct: 367 IGAGTNEIRRFLIGREL 383 Lambda K H 0.317 0.135 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 386 Length adjustment: 30 Effective length of query: 349 Effective length of database: 356 Effective search space: 124244 Effective search space used: 124244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory