Align Lysine/ornithine decarboxylase; LDC; EC 4.1.1.17; EC 4.1.1.18 (uncharacterized)
to candidate CCNA_00365 CCNA_00365 ornithine decarboxylase
Query= curated2:O50657 (393 letters) >FitnessBrowser__Caulo:CCNA_00365 Length = 419 Score = 162 bits (410), Expect = 2e-44 Identities = 116/347 (33%), Positives = 178/347 (51%), Gaps = 22/347 (6%) Query: 43 RAGVFYAMKANPTPEILSLLAGLGSH-FDVASAGEMEILHELGVDGSQMIYANPVKDARG 101 + VFYA+KANP+P ++ LA G FDVAS E+E++ GS+M + +PVK Sbjct: 40 KGDVFYAVKANPSPWVIRELAKAGVRSFDVASLNEVELVAN-EAPGSRMAFMHPVKSRAA 98 Query: 102 LKAAA-DYNVRRFTFDDPSEIDKMAKAVPGA---DVLVRIAVRNNKALVDLNTKFGAPVE 157 + AA D+ V+ F+FD E+ K+ A A +++VR+ V+ A L+ KFG + Sbjct: 99 ISAAYFDHGVKTFSFDTHEELAKILDATGQAKDLNLIVRMGVQAEGAAYSLSGKFGVEMH 158 Query: 158 EALDLLKAAQDAGLHAMGICFHVGSQSLSTAAYEEALLVARRLFDEAEEMGMHLTDLDIG 217 A DLL AA+ A MG+ FHVGSQ + A++ A+ A R A G+ +D+G Sbjct: 159 NAPDLLLAARRATQDLMGVSFHVGSQCMRPTAFQAAMAQASRALVRA---GVLADVVDVG 215 Query: 218 GGFPVPDAKGLNVDLAAMMEAINKQIDRLF--PDTAVWTEPGRYMCGTAVNLVTSVIGTK 275 GGFP + DL+ + AI++ + T +W EPGR + A +L+ V Sbjct: 216 GGFPSIYPGMVPPDLSEYLAAIDRGFAEMMVHETTELWCEPGRALVAEASSLLVKV--EL 273 Query: 276 TRGEQPWYILDEGIYGCFSGIMYDHWTYPLHCFGKGNK------KPSTFGGPSCDGIDVL 329 +G+ + L++G YG + W +P+ + K + KP F GP+CD +D + Sbjct: 274 KKGDALY--LNDGSYGSLFDAAHMKWPFPVKLYRKSGEVVEEGLKPFRFYGPTCDSVDHM 331 Query: 330 YRDFMAPE-LKIGDKVLVTEMGSYTSVSATRFNGFYLAPTIIFEDQP 375 F PE + GD + + +G+Y TRFNGF T +D P Sbjct: 332 PGPFYLPESVDEGDYIEIGMLGAYGVAMNTRFNGFGETDTAQVQDAP 378 Lambda K H 0.320 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 28 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 419 Length adjustment: 31 Effective length of query: 362 Effective length of database: 388 Effective search space: 140456 Effective search space used: 140456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory