Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate CCNA_00871 CCNA_00871 carbon-nitrogen hydrolase family protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_4777 (264 letters) >FitnessBrowser__Caulo:CCNA_00871 Length = 283 Score = 79.0 bits (193), Expect = 1e-19 Identities = 66/178 (37%), Positives = 90/178 (50%), Gaps = 17/178 (9%) Query: 93 NAVQLIDAQGERLANYRKSHLFG-DL------------DHAMFSAGDAALPIVELNGWKL 139 N +ID G +A Y K H+F DL + + + GDAA+ +V+ KL Sbjct: 102 NRQVVIDPTGAIVATYDKLHMFDVDLPPRDGKAGETARESSAYEPGDAAV-VVDTPWAKL 160 Query: 140 GLLICYDLEFPENARRLALAGAELILVPTANMQPY-EFIADVTVRARAIENQCFVAYANY 198 GL ICYD+ FP R LALAGA ++ VP A +P E ++ +RARAIE FV A Sbjct: 161 GLTICYDMRFPALHRALALAGATVLTVPAAFTRPTGEAHWEILLRARAIETGSFVLAAAQ 220 Query: 199 CG-HEGELQYCGQSSIAAPNGSRPALAGLDE-ALIVAELDRQLMDDSRAAYNYLHDRR 254 G HE G+S + P G A DE +++A+LD D +RAA L + R Sbjct: 221 GGFHEDGRGTWGRSIVVGPWGEIIATLDHDEPGVLLADLDLPAADKARAAIPALKNAR 278 Lambda K H 0.321 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 283 Length adjustment: 25 Effective length of query: 239 Effective length of database: 258 Effective search space: 61662 Effective search space used: 61662 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory