Align ABC transporter for L-Lysine, permease component 1 (characterized)
to candidate CCNA_01507 CCNA_01507 cystine transport system permease protein
Query= reanno::pseudo5_N2C3_1:AO356_05500 (242 letters) >FitnessBrowser__Caulo:CCNA_01507 Length = 219 Score = 125 bits (315), Expect = 5e-34 Identities = 81/223 (36%), Positives = 119/223 (53%), Gaps = 11/223 (4%) Query: 16 LQGFGPLLMQGTWMTIKLSALSLLLSVLLGLLGASAKLSRVKLLRIPAQLYTTLIRGVPD 75 L+ PLL++G TI LS + + + V+LG L A +LSR LLR PA +Y + RG P Sbjct: 8 LRQSAPLLLKGAGYTIVLSVIGMSIGVVLGFLLALMRLSRSALLRWPAGVYVSAFRGTPL 67 Query: 76 LVLMLLIFYSLQTWLTSFTDFMEWEYIEIDPFGAGVITLGFIYGAYFTETFRGAILAVPR 135 LV + LI+Y L + +E+ P A I AY E R AI AV + Sbjct: 68 LVQLFLIYYGLPQF-----------GLEMPPLVAAGIGFSLNVAAYSCEILRSAIAAVDK 116 Query: 136 GQVEAATAYGLKRGQRFRFVVFPQMMRFALPGIGNNWMVMLKATALVSIIGLADLVKAAQ 195 GQ EAA+ G+ RGQ R V+ PQ R A+ + N+++ ++K T+L + I + +L + AQ Sbjct: 117 GQWEAASVLGMSRGQTLRRVILPQAARTAVAPLSNSFISLVKDTSLAATIQVPELFRQAQ 176 Query: 196 DAGKSTYQLFYFLVLAALIYLLITSASNFILRWLERRYAAGAR 238 TY++F + AA IY ++++ LERR A G R Sbjct: 177 LITARTYEIFTLYLAAAAIYWILSTILAAAQTRLERRAAEGRR 219 Lambda K H 0.329 0.142 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 219 Length adjustment: 23 Effective length of query: 219 Effective length of database: 196 Effective search space: 42924 Effective search space used: 42924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory