Align D-2-hydroxyglutarate dehydrogenase (EC 1.1.99.39) (characterized)
to candidate CCNA_03500 CCNA_03500 FAD/FMN-containing dehydrogenase
Query= BRENDA::O23240 (559 letters) >FitnessBrowser__Caulo:CCNA_03500 Length = 469 Score = 290 bits (741), Expect = 1e-82 Identities = 161/457 (35%), Positives = 254/457 (55%), Gaps = 9/457 (1%) Query: 100 VSYFKEILGEKNVVEDKERLETANTDWMHKYKGSSKLMLLPKNTQEVSQILEYCDSRRLA 159 VS K +LGE +D++ + +W +++G + L++ P++T EV+ ++ C + +A Sbjct: 10 VSRLKAVLGEGGWSQDRDVIAPKLVEWRGRWQGETPLLVTPRSTAEVAAVVGICAAEGVA 69 Query: 160 VVPQGGNTGLVGGSVPVFDEVIVNVGLMNKILSFDEVSGVLVCEAGCILENLATFLDTKG 219 + PQGGNTGLV G +P E++++ + I D + +V EAG L G Sbjct: 70 ITPQGGNTGLVAGQIPR-GEILLSTQKLTAIRDVDPIDDAMVLEAGVTLYEAHQQAAKVG 128 Query: 220 FIMPLDLGAKGSCHIGGNVSTNAGGLRLIRYGSLHGTVLGLEAVTANGNVLDMLGTLRKD 279 + + ++GSC IGG +STNAGG ++RYG + VLG+EAV NG + + L LRKD Sbjct: 129 RRFTVGVASEGSCTIGGLISTNAGGTAVLRYGMMREQVLGIEAVLPNGEIWNGLKRLRKD 188 Query: 280 NTGYDLKHLFIGSEGSLGIVTKVSILTQPKLSSVNLAFIACKDYLSCQKLLVEAKRNLGE 339 NTGYDLK L IG+EG+LGIVT S+ Q L+S +A + + +LL AK G Sbjct: 189 NTGYDLKQLLIGAEGTLGIVTAASLKLQALLASRAVAIVGLASPANAIQLLARAKDETGG 248 Query: 340 ILSAFEFLDNNSMDLVLNHLDGVRNPVSSSENFYILIETTGSDETNDREKLEAFLLKSLE 399 + AFE + +L + ++ G+R+P+ + +Y+LIE + LE L +LE Sbjct: 249 AVEAFELMGRLGFELTVRNVPGLRDPLPEAHPWYVLIEIASGEPGAAEAALERLLAGALE 308 Query: 400 KGLVSDGVIAQDINQASSFWRIREGITEALQKAGAVYKYDLSLPVEEIYNIVNDLRGRLG 459 +GL++D +AQ Q +FW IREG + + GAV+K+D+S+PV +I + + + Sbjct: 309 RGLIADAAVAQTETQMKAFWHIREGHSAGQKPEGAVWKHDVSVPVSKIPDFIGQANAAIE 368 Query: 460 DL---ANVMGYGHLGDGNLHLNI-----SAAEYNDKLLGLIEPYVYEWTSKHRGSISAEH 511 ++ +GH+GDGN+H ++ + + V++ T+ GSISAEH Sbjct: 369 KSFPGTRIVAFGHVGDGNVHYDVLQPVGGDGDAHGAQREAGAKIVHDITAGFGGSISAEH 428 Query: 512 GLGVMKANEIFYSKSPETVALMASIKKLLDPKGILNP 548 GLG MK E K P VA + +I+ LDP+ I+NP Sbjct: 429 GLGAMKTAEALTYKDPIEVAALRAIRGALDPQRIMNP 465 Lambda K H 0.317 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 590 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 559 Length of database: 469 Length adjustment: 35 Effective length of query: 524 Effective length of database: 434 Effective search space: 227416 Effective search space used: 227416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory