Align Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; xSMP-30; EC 3.1.1.17 (characterized)
to candidate CCNA_01882 CCNA_01882 SMP-30/gluconolaconase/LRE-like protein
Query= SwissProt::Q9I922 (299 letters) >FitnessBrowser__Caulo:CCNA_01882 Length = 293 Score = 153 bits (387), Expect = 4e-42 Identities = 95/294 (32%), Positives = 144/294 (48%), Gaps = 13/294 (4%) Query: 6 IECVVSETYKIGESPVWEEKEGTLLFVDITGQKVCRWDPSTKKVQSVSVEAPIGSVALRK 65 +E + E ++GESP+W+ G L +VD + R+DP T + +S+ PIGSV L + Sbjct: 5 VEIIGKERCRLGESPLWDADAGVLYWVDSMAPAIWRYDPFTSEQRSIPAPKPIGSVVLGR 64 Query: 66 SGGYVLAMGNTFSALNWEDQSVTTLARVDEDKPNNRFNDGKVDPEGRFLAGTMSQEIRPA 125 G + + + + + + T +A D P RFNDGK D +GRF+ GTM+ Sbjct: 65 PGELIAGLADGVYRVQLDTGAFTPIALPDTLAPIERFNDGKADRQGRFVTGTMAMHNETG 124 Query: 126 VVER----NQGSLFTLYPDHSVVKHFDMVDISNGLDWSLDHKTLYYIDSLSFKVDALDYD 181 + + + G + + P + ++I+N +S TLY+ DSL V A YD Sbjct: 125 RIGKLYRFSAGGAWEVLPT-------EPIEIANSTCFSPSGDTLYFADSLRHMVWAFSYD 177 Query: 182 MKTGKSSNRRTLYKLQQDEGIPDGMCIDAEGKLWVACYNGGRVIRIDPETGKQIQTVKLP 241 KTG +R + PDG +DAEG +W+A ++IRI P+ G+ + V+ P Sbjct: 178 PKTGAVGEKRDFFDTTGFNSAPDGATVDAEGHIWLALVQAQKLIRISPD-GRLDRVVESP 236 Query: 242 IDKTTSCCFGGPDYSEMYVTSACDGMDEDWKKRQPQSGGIYKITGLGVKGIAPT 295 + FGG D +YVTS D K SG + GLGV+GIA T Sbjct: 237 APFCSCPAFGGEDLDILYVTSISDSGGR-LKTDVDASGRLMAFHGLGVRGIAET 289 Lambda K H 0.316 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 293 Length adjustment: 26 Effective length of query: 273 Effective length of database: 267 Effective search space: 72891 Effective search space used: 72891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory