Align Probable NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Short chain dehydrogenase/reductase; YlSDR; EC 1.1.1.138 (characterized)
to candidate CCNA_03491 CCNA_03491 gluconate 5-dehydrogenase (Ga5DH)-related protein
Query= SwissProt::Q6CEE9 (278 letters) >FitnessBrowser__Caulo:CCNA_03491 Length = 260 Score = 134 bits (338), Expect = 2e-36 Identities = 85/255 (33%), Positives = 141/255 (55%), Gaps = 11/255 (4%) Query: 29 FSLKGKVASITGSSSGIGFAVAEAFAQAGADVAIWYNSKPSDEKAEYLSKTYGVRSKAYK 88 F+L GKVA +TG + GIG +A+A AQAGAD+ IW ++ + AE GVR KA Sbjct: 6 FNLSGKVALVTGGNRGIGLGMAKAMAQAGADIVIWGSNPERNLAAEQTLTALGVRVKAQT 65 Query: 89 CAVTNAKQVETTIQTIEKDFGKIDIFIANAGIPWTAGPMIDVPNNEEWDKVVDLDLNGAY 148 V++ QV ++ G++D ANAGI + + +D+ + E + KV+ ++L+G + Sbjct: 66 VDVSDEAQVREGMEEAVAAMGRVDSVFANAGIGYGSPSFVDM-STEVYRKVLAVNLDGVF 124 Query: 149 YCAKYAGQIFKKQGY-----GSFIFTASMSGHIVNIPQMQACYNAAKCAVLHLSRSLAVE 203 + + A + ++ GS + AS++ + Y A K AV+ + +S+AVE Sbjct: 125 FTLREACRHMVERAKAGDPGGSLVGVASLAA--IEGAARNEAYAATKGAVISMIKSVAVE 182 Query: 204 WAGF-ARCNTVSPGYMATEISDFIPRDT--KEKWWQLIPMGREGDPSELAGAYIYLASDA 260 A + R N + PG++AT+++ + EK +P R G+P + G +YLASDA Sbjct: 183 HARYGVRANAILPGWIATDMTAGAQGNAAFAEKVIPRVPARRWGEPEDFGGMAVYLASDA 242 Query: 261 STYTTGADILVDGGY 275 S+Y +G +++DGGY Sbjct: 243 SSYHSGTTLVIDGGY 257 Lambda K H 0.317 0.132 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 260 Length adjustment: 25 Effective length of query: 253 Effective length of database: 235 Effective search space: 59455 Effective search space used: 59455 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory