Align Fructokinase-1; Fructokinase I; OsFKI; EC 2.7.1.4 (characterized)
to candidate CCNA_01001 CCNA_01001 ribokinase
Query= SwissProt::Q0JGZ6 (323 letters) >FitnessBrowser__Caulo:CCNA_01001 Length = 303 Score = 88.2 bits (217), Expect = 2e-22 Identities = 94/308 (30%), Positives = 135/308 (43%), Gaps = 38/308 (12%) Query: 21 TVAGVSLAEAPAFVKAPGGAPANVAIAVARLGGGAAFVGKLGDDEFGRMLAAILRDNGVD 80 TVAG+SL F+ GG AN A+A AR+G +G +G D+ G L A L GV Sbjct: 26 TVAGLSLE---LFL---GGKGANQAVAAARMGVATRLMGAVGGDDSGAGLKAKLAGYGVQ 79 Query: 81 DGGVVFDAGARTALAFVTLRADGEREFMFYRNPSADMLLTHAELNVELIKRAAVFHYGSI 140 G VV G T A V + E M A+ ++T ++ I+ V + Sbjct: 80 VGDVVELPGVPTGQAHVWVANSAEN--MIVVTAGANAMVTPQQVAATTIEGQRVL----L 133 Query: 141 SLIAEPCRSAH-LRAMEIAKEAGALLSYDPNLREALWPSREEARTKILSIWDQADIVKVS 199 + P + L AK A +L+ P L + +++ DI+ V+ Sbjct: 134 CQLETPATAIETLFRAGSAKGALRILNAAPALPQG------------AALFPLTDILIVN 181 Query: 200 EVELEFLTGID----SVEDDVV--MKLWRPTMKLLLVTLGDQGCKYYARDFRGAVPSYKV 253 + EL +D +E+ V KL + ++VTLG G RD V KV Sbjct: 182 QTELATYAKLDREPVKLEEVSVAARKLMSRPDQTIIVTLGAAGAAVVRRDEAFLVEGKKV 241 Query: 254 QQVDTTGAGDAFVGALLRRIVQDPSSLQDQKKLEEAIKFANACGAITATKKGAIPSLPTE 313 + VDT GAGD F GAL ++L L EA++ ANA A++ K GA PS+P Sbjct: 242 KAVDTVGAGDCFCGAL-------AATLAAGMDLAEAVETANAAAALSVQKAGAAPSMPNR 294 Query: 314 VEVLKLME 321 EV +E Sbjct: 295 REVEAFLE 302 Lambda K H 0.320 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 303 Length adjustment: 27 Effective length of query: 296 Effective length of database: 276 Effective search space: 81696 Effective search space used: 81696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory