Align Myo-inosose-2 dehydratase (EC 4.2.1.44) (characterized)
to candidate CCNA_01358 CCNA_01358 myo-inositol catabolism protein IolE
Query= reanno::Smeli:SMc00433 (300 letters) >FitnessBrowser__Caulo:CCNA_01358 Length = 299 Score = 279 bits (713), Expect = 6e-80 Identities = 143/300 (47%), Positives = 187/300 (62%), Gaps = 4/300 (1%) Query: 2 IRYGTNPIAWSNDDDHSIGAHLTLEDCLSDCRKIGFDGIEKGHKMPSDPEALKQKLSSYD 61 IR+G +PIAW NDD +G LE L+DC+ IGF+G+E G P DP LK L Y Sbjct: 3 IRFGVSPIAWINDDMPELGGDTPLESVLADCQAIGFEGVELGGVFPRDPAVLKPLLDRYG 62 Query: 62 LVFVSGWHSTNLLTHDVEAEKKAIQPHLDLLKHNGCKVAIVCETSNAIHGDDSKSLVKDK 121 L V GW+S NLL H E E A+QPHL LLK GC V I ETSNAIHG +L Sbjct: 63 LDLVGGWYSGNLLAHSAEDEIAALQPHLALLKAMGCTVFIHAETSNAIHGARDTAL-SAT 121 Query: 122 PVLPADKWEKFGTDLEAIAEYCAGQGVDLVYHHHMGTIVQTGEEIDLLMRNTGPATKLLL 181 P L A+ W FG L +A+Y A QG+ YHHH+GT+V+ ++++ + TGP+ L + Sbjct: 122 PRLDAEGWTLFGARLTKVADYIAAQGLKFAYHHHLGTVVERPQDLEAFLGATGPSVGLTV 181 Query: 182 DTGHAWFGGSDPAEVARKYMGRVRHIHCKNVRPAV-RKVVEGEGLSFLEGVRRGVFTVPG 240 DTGHA GG DP + R + RV H+HCK+VR V + V+ +G SFL+GV G+FTVPG Sbjct: 182 DTGHAALGGVDPVALIRAHPERVAHVHCKDVRREVFQSVIGQKGGSFLDGVLAGMFTVPG 241 Query: 241 DEEGGVDFLPVLKTAAEHGYDGWLVIEAEQDSAVRNPFEYQSLGLKSLKTFAREAGLDRA 300 D GG+D+ V++ AE Y GW+++EAEQD A+ NP +Y +GL +LK A GL A Sbjct: 242 D--GGLDYAAVMQALAEINYSGWIIVEAEQDPAIANPRQYGEMGLATLKKEAAATGLRAA 299 Lambda K H 0.318 0.137 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 299 Length adjustment: 27 Effective length of query: 273 Effective length of database: 272 Effective search space: 74256 Effective search space used: 74256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate CCNA_01358 CCNA_01358 (myo-inositol catabolism protein IolE)
to HMM TIGR04379 (iolE: myo-inosose-2 dehydratase (EC 4.2.1.44))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR04379.hmm # target sequence database: /tmp/gapView.2030785.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR04379 [M=290] Accession: TIGR04379 Description: myo_inos_iolE: myo-inosose-2 dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-118 380.4 0.0 3.9e-118 380.2 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_01358 CCNA_01358 myo-inositol cataboli Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_01358 CCNA_01358 myo-inositol catabolism protein IolE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 380.2 0.0 3.9e-118 3.9e-118 2 288 .. 3 289 .. 2 291 .. 0.98 Alignments for each domain: == domain 1 score: 380.2 bits; conditional E-value: 3.9e-118 TIGR04379 2 vklgiaPiaWvndDlpelggdttleqvlseaaeagfsgtElgnkfpkdpavLkaaleerglelvsgwfsalll 74 +++g++PiaW+ndD+pelggdt+le+vl++++++gf+g+Elg fp+dpavLk++l+++gl+lv+gw+s++ll lcl|FitnessBrowser__Caulo:CCNA_01358 3 IRFGVSPIAWINDDMPELGGDTPLESVLADCQAIGFEGVELGGVFPRDPAVLKPLLDRYGLDLVGGWYSGNLL 75 89*********************************************************************** PP TIGR04379 75 eksveeeieavrehlellkalgakvivvaEvgksiqgdkdtplaerpklteeeweelaeklnklgeilkekgl 147 ++s+e+ei+a++ hl+llka+g++v++ aE++++i+g +dt+l+ p+l++e w+ ++++l+k++++++ +gl lcl|FitnessBrowser__Caulo:CCNA_01358 76 AHSAEDEIAALQPHLALLKAMGCTVFIHAETSNAIHGARDTALSATPRLDAEGWTLFGARLTKVADYIAAQGL 148 ************************************************************************* PP TIGR04379 148 klayHhHlgtvveteeeidrlmeltdpelvgllyDtGHlvfagedplavlekyadRiahvHlKDvRkevleev 220 k+ayHhHlgtvve+ ++++ ++ +t+p+ vgl+ DtGH++++g dp+a+++ + +R+ahvH+KDvR+ev+++v lcl|FitnessBrowser__Caulo:CCNA_01358 149 KFAYHHHLGTVVERPQDLEAFLGATGPS-VGLTVDTGHAALGGVDPVALIRAHPERVAHVHCKDVRREVFQSV 220 ****************************.******************************************98 PP TIGR04379 221 r.kekksFldavlkGvftvPGdGcidfeeilealkakdYeGWlvvEaEqDPakaepleyakkakkylee 288 ++ sFld+vl+G+ftvPGdG +d++++++al++ +Y+GW++vEaEqDPa+a+p +y +++ +l++ lcl|FitnessBrowser__Caulo:CCNA_01358 221 IgQKGGSFLDGVLAGMFTVPGDGGLDYAAVMQALAEINYSGWIIVEAEQDPAIANPRQYGEMGLATLKK 289 625678**********************************************************99987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (290 nodes) Target sequences: 1 (299 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 22.20 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory