Align BadI (characterized)
to candidate CCNA_01794 CCNA_01794 enoyl-CoA hydratase/isomerase family
Query= metacyc::MONOMER-892 (260 letters) >FitnessBrowser__Caulo:CCNA_01794 Length = 256 Score = 87.8 bits (216), Expect = 2e-22 Identities = 63/208 (30%), Positives = 95/208 (45%), Gaps = 4/208 (1%) Query: 6 LIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDRAFCTG 65 L+ E R +A + +NRP+ MNA L A+ + D DV ++L GAGDRAF G Sbjct: 2 LLIERRGAIAIVTLNRPEAMNALSKALRLALHDAIVQLDQDPDVSVVILTGAGDRAFTAG 61 Query: 66 GDQSTHDGNYDGRGTVGLPMEELH--TAIRDVPKPVIARVQGYAIGGGNVLATICDLTIC 123 D G+ G + A+ KPVI + G AI GG LA CD+ + Sbjct: 62 LDLKELGGDPAAMGAANDQDARSNPVRAVETCRKPVIGAINGVAITGGFELALACDVLLA 121 Query: 124 SEKAIFGQVGPKMGSVDPGYG-TAFLARVVGEKKAREIWYMCKRYSGKEAEAMGLANLCV 182 SE A F ++G + PG+G + L+R++G +A+E+ + A GL N Sbjct: 122 SENARFADTHARVG-IMPGWGLSQKLSRLIGPYRAKELSLTGNFLDARTAADWGLVNRVT 180 Query: 183 PHDELDAEVQKWGEELCERSPTALAIAK 210 EL + +++ AL+ K Sbjct: 181 TASELLPTALRMAQDMASIPVEALSFYK 208 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 256 Length adjustment: 24 Effective length of query: 236 Effective length of database: 232 Effective search space: 54752 Effective search space used: 54752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory