Align phenylalanine 4-monooxygenase (EC 1.14.16.1) (characterized)
to candidate CCNA_01684 CCNA_01684 phenylalanine-4-hydroxylase
Query= BRENDA::P30967 (297 letters) >FitnessBrowser__Caulo:CCNA_01684 Length = 294 Score = 339 bits (870), Expect = 4e-98 Identities = 154/261 (59%), Positives = 199/261 (76%) Query: 26 DFTLPQPLDRYSAEDHATWATLYQRQCKLLPGRACDEFMEGLERLEVDADRVPDFNKLNQ 85 D+T+ Q + Y+ +H W TLY+RQ +L GRACDEFM GL+ L++ +PDF ++N+ Sbjct: 17 DWTIDQGWETYTQAEHDVWITLYERQTDMLHGRACDEFMRGLDALDLHRSGIPDFARINE 76 Query: 86 KLMAATGWKIVAVPGLIPDDVFFEHLANRRFPVTWWLREPHQLDYLQEPDVFHDLFGHVP 145 +L TGW +VAVPGL+PDDVFF+HLANRRFP ++R+PH+LDYLQEPD+FHD+FGHVP Sbjct: 77 ELKRLTGWTVVAVPGLVPDDVFFDHLANRRFPAGQFIRKPHELDYLQEPDIFHDVFGHVP 136 Query: 146 LLINPVFADYLEAYGKGGVKAKALGALPMLARLYWYTVEFGLINTPAGMRIYGAGILSSK 205 +L +PVFADY++AYG+GG +A LG L LARLYWYTVEFGL+NTPAG+RIYGAGI+SS+ Sbjct: 137 MLTDPVFADYMQAYGEGGRRALGLGRLANLARLYWYTVEFGLMNTPAGLRIYGAGIVSSR 196 Query: 206 SESIYCLDSASPNRVGFDLMRIMNTRYRIDTFQKTYFVIDSFKQLFDATAPDFAPLYLQL 265 +ESI+ LD SPNR+GFDL R+M T YRID FQ+ YFVIDS + L + T DF +Y +L Sbjct: 197 TESIFALDDPSPNRIGFDLERVMRTLYRIDDFQQVYFVIDSIQTLQEVTLRDFGAIYERL 256 Query: 266 ADAQPWGAGDVAPDDLVLNAG 286 A G ++ P D VL G Sbjct: 257 ASVSDIGVAEIVPGDAVLTRG 277 Lambda K H 0.323 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 294 Length adjustment: 26 Effective length of query: 271 Effective length of database: 268 Effective search space: 72628 Effective search space used: 72628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate CCNA_01684 CCNA_01684 (phenylalanine-4-hydroxylase)
to HMM TIGR01267 (phhA: phenylalanine-4-hydroxylase (EC 1.14.16.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01267.hmm # target sequence database: /tmp/gapView.5704.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01267 [M=248] Accession: TIGR01267 Description: Phe4hydrox_mono: phenylalanine-4-hydroxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-110 354.7 0.0 1.3e-110 354.5 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_01684 CCNA_01684 phenylalanine-4-hydro Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_01684 CCNA_01684 phenylalanine-4-hydroxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 354.5 0.0 1.3e-110 1.3e-110 1 242 [. 17 259 .. 17 265 .. 0.98 Alignments for each domain: == domain 1 score: 354.5 bits; conditional E-value: 1.3e-110 TIGR01267 1 dftvaqdldryseeehavwatlidrqlkllegracdeyldGveklgldadripdleevneklraltGwkivav 73 d+t++q+++ y++ eh vw tl++rq+ +l+gracde++ G++ l+l+ ipd+ +ne l++ltGw +vav lcl|FitnessBrowser__Caulo:CCNA_01684 17 DWTIDQGWETYTQAEHDVWITLYERQTDMLHGRACDEFMRGLDALDLHRSGIPDFARINEELKRLTGWTVVAV 89 6799********************************************************************* PP TIGR01267 74 pglipadvffehlanrrfpvttflrtpeeldylqepdvfhdlfGhvpllsnpvfadfleayGkkgvkakalga 146 pgl+p+dvff+hlanrrfp +f+r+p+eldylqepd+fhd+fGhvp+l++pvfad+++ayG +g +a lg+ lcl|FitnessBrowser__Caulo:CCNA_01684 90 PGLVPDDVFFDHLANRRFPAGQFIRKPHELDYLQEPDIFHDVFGHVPMLTDPVFADYMQAYGEGGRRALGLGR 162 ************************************************************************9 PP TIGR01267 147 a.llarlywytvefGlvetaaglriyGaGilsskkelvyaleskeplrvafdllevmrtryridklqkayfvl 218 larlywytvefGl++t+aglriyGaGi+ss +e+++al+ +p+r++fdl++vmrt yrid +q++yfv+ lcl|FitnessBrowser__Caulo:CCNA_01684 163 LaNLARLYWYTVEFGLMNTPAGLRIYGAGIVSSRTESIFALDDPSPNRIGFDLERVMRTLYRIDDFQQVYFVI 235 879********************************************************************** PP TIGR01267 219 pslkrlfdaaqedfealvaeakdl 242 +s++ l +++ df a++ +++ lcl|FitnessBrowser__Caulo:CCNA_01684 236 DSIQTLQEVTLRDFGAIYERLASV 259 ******************998765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (294 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.48 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory