Align BadK (characterized)
to candidate CCNA_00006 CCNA_00006 enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__Caulo:CCNA_00006 Length = 262 Score = 246 bits (627), Expect = 5e-70 Identities = 128/247 (51%), Positives = 167/247 (67%) Query: 9 ETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGADIA 68 E+ V +I LNRP+ LNALN AL+ L AL A ADD +G IV+ G+ +AFAAGADI Sbjct: 13 ESAPGVTLIRLNRPEALNALNTALLGELAQALAAAQADDSVGCIVLTGSAKAFAAGADIK 72 Query: 69 SMAAWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGRSAKF 128 M+ +Y+ ++ ++F T I Q RKP++AAVAG A GGGCELA+ CD ++A +AKF Sbjct: 73 EMSDKTYAQMFKADFFTAGARAIEQCRKPIIAAVAGYALGGGCELAMMCDFILAADTAKF 132 Query: 129 ALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDDRLRD 188 PEI LG+ PG GGTQRL R +GK+KAMDM L+ R + AEEA+R GLVSR+ D L D Sbjct: 133 GQPEINLGVAPGIGGTQRLTRFVGKSKAMDMILTGRMMGAEEAERSGLVSRIFPADSLVD 192 Query: 189 ETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAREGIQAFL 248 ET+A+A IA S A+ KE + A+E+TL G+ ERR H+ FA D +EG+ AF+ Sbjct: 193 ETLAIAAKIAGQSPLAVAMNKELVEAAYETTLTTGVALERRLFHSLFAFEDQKEGMTAFV 252 Query: 249 EKRAPCF 255 EKR P F Sbjct: 253 EKRKPLF 259 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 262 Length adjustment: 24 Effective length of query: 234 Effective length of database: 238 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory