Align BadK (characterized)
to candidate CCNA_03293 CCNA_03293 multifunctional fatty acid oxidation complex subunit alpha FadJ
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__Caulo:CCNA_03293 Length = 696 Score = 134 bits (337), Expect = 5e-36 Identities = 85/221 (38%), Positives = 123/221 (55%), Gaps = 16/221 (7%) Query: 11 QGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGADIA-- 68 +G +G++TLN P V NAL+ A+ + L GA A AD + AIV+ + + F AGADI Sbjct: 17 EGDIGVVTLNSPPV-NALSAAVREGLQGAFDAAIADAAVKAIVLICDGKTFIAGADITEF 75 Query: 69 --SMAAWSYSDVYGSNFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGRSA 126 +M S DV I KPV+AA+ G A GGG E+AL + +A SA Sbjct: 76 GKAMTGPSLQDVQN---------VIENSPKPVIAAIHGTALGGGLEVALVANYRVAVPSA 126 Query: 127 KFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDDRL 186 K LPE+ +GLLPGAGGTQRLPR +G KA++M + + + A+ A GL +V++ +L Sbjct: 127 KAGLPEVNIGLLPGAGGTQRLPRIVGVEKALEMVTTGQHVPAKAAHAMGLFDELVEEGKL 186 Query: 187 RDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFE 227 R+ +A A + A + P + LN E+ + +FE Sbjct: 187 REGAIAFAKAVVAENRP--LKKVRDLNEKVEAARGKPEIFE 225 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 696 Length adjustment: 32 Effective length of query: 226 Effective length of database: 664 Effective search space: 150064 Effective search space used: 150064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory