Align fumarylacetoacetate (FAA) hydrolase (EC 3.7.1.2) (characterized)
to candidate CCNA_02614 CCNA_02614 fumarylacetoacetase superfamily protein
Query= reanno::psRCH2:GFF3447 (327 letters) >FitnessBrowser__Caulo:CCNA_02614 Length = 335 Score = 399 bits (1025), Expect = e-116 Identities = 213/338 (63%), Positives = 243/338 (71%), Gaps = 18/338 (5%) Query: 1 MKLATLNQGRDGVLVVVSRDLAQAVKVPQIAATLQAALDDWNYCKPKLEAVYQRLNDGLE 60 MKLA+L GRDG LVVVS DLA IA TLQAALD+W C P L L + LE Sbjct: 1 MKLASLKGGRDGRLVVVSNDLAWFTDAGTIAPTLQAALDNWERCGPMLAG----LAESLE 56 Query: 61 EGAFA---FDQTACHSPLPRAYHWADGSAYVNHVELVRKARGAEMPESFWHDPLMYQGGA 117 GA F + SPLPRAY W DGSAYVNHV+LVRKARGAEMPESFW DPLMYQG + Sbjct: 57 HGAVPKERFHEHEALSPLPRAYQWVDGSAYVNHVQLVRKARGAEMPESFWTDPLMYQGAS 116 Query: 118 DAFIPPHSPIRLADEAWGIDLEGELAVITDDVPMGATPAEAASHIQLLMLVNDVSLRNLI 177 D F+ P PI LAD +WG DLEGE+AVI DDVP+GAT EA + I+L+ML NDVSLRNLI Sbjct: 117 DGFLAPRDPIPLADASWGCDLEGEVAVIVDDVPLGATREEALAAIRLVMLCNDVSLRNLI 176 Query: 178 PGELAKGFGFYQSKPSSSFSPVAVTPDELGETWRDGKVHRPLVSHINGELFGQPDAGTDM 237 PGELAKGFGF QSKP+S+FSPVAV+PD LGE W+ GK+H L+ ++G+ FG+ DAG DM Sbjct: 177 PGELAKGFGFLQSKPASAFSPVAVSPDALGEAWKGGKLHGALLVELDGKDFGRADAGVDM 236 Query: 238 TFNFPTLVAHAARTRPLGAGTIIGSGTVSNYDRSAGS-----------SCLAEKRMLEVV 286 TF+F TLVAHAA+TR L AGTI+GSGTVSN D G SCLAE R +E + Sbjct: 237 TFDFGTLVAHAAKTRSLCAGTIVGSGTVSNRDADGGPGKPISEGGLGYSCLAEVRTVETL 296 Query: 287 EHGEAKTPFLKFGDRVRIEMFDAAGQSIFGAIDQQVER 324 HG KTPFL GD +RIEM DA G SIFGAI+Q VER Sbjct: 297 LHGAPKTPFLLGGDTIRIEMKDAKGHSIFGAIEQTVER 334 Lambda K H 0.318 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 335 Length adjustment: 28 Effective length of query: 299 Effective length of database: 307 Effective search space: 91793 Effective search space used: 91793 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory