GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaJ1 in Caulobacter crescentus NA1000

Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate CCNA_00544 CCNA_00544 acetyl-CoA acetyltransferase

Query= metacyc::MONOMER-15952
         (401 letters)



>lcl|FitnessBrowser__Caulo:CCNA_00544 CCNA_00544 acetyl-CoA
           acetyltransferase
          Length = 391

 Score =  320 bits (819), Expect = 6e-92
 Identities = 185/406 (45%), Positives = 261/406 (64%), Gaps = 20/406 (4%)

Query: 1   MNEALIIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQA 60
           M+E +I+ A RTP+G + GALAS+ A +LG   ++A ++R   +  S VD+VI G   QA
Sbjct: 1   MSEIVIVSAARTPVGSFNGALASLPASELGKAVIEAAVSR-AGIAPSDVDEVILGQVLQA 59

Query: 61  GEDNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESM 120
               +  AR A++ AG+PV  P  +LN+LCGSGL AV  AA+ +  G A +++AGG ESM
Sbjct: 60  AA-GQGPARQASVKAGIPVEAPAWSLNQLCGSGLRAVALAAQQIADGSAKVVVAGGQESM 118

Query: 121 SRAPFVMG-KSEQAFGRSAEIFDTTIGWRFVNKLMQQG----FGIDSMPETAENVAAQFN 175
           S+AP     +  Q  G            +FV+ +++ G    F    M +TAEN+A+++ 
Sbjct: 119 SQAPHAQNLRGGQKMG----------DLQFVDTMIKDGLWDAFHGYHMGQTAENIASRWQ 168

Query: 176 ISRADQDAFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQL 235
           I+R DQD FA+ SQ++A AA   G+   EIV + I  RKG   IV+ DE  R   T+E +
Sbjct: 169 ITREDQDKFAVTSQNRAEAAQKAGKFDDEIVPITIKGRKGDT-IVDKDEFIRHGATIESV 227

Query: 236 AKLGTPFRQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRIM 295
             L   F + GSVTA NASG+NDGA AL+L S+E A + GLK  AR+   A AGVEP IM
Sbjct: 228 QGLKPVFNKEGSVTAANASGLNDGAAALVLMSAEEAAKRGLKPLARIASWANAGVEPEIM 287

Query: 296 GIGPVPATRKVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVNPNGGAIAL 355
           G GP+PA++K LE  G +++D+D++E NEAFAAQ L V+RELGL  D  +VN NGGAIA+
Sbjct: 288 GTGPIPASKKALEKAGWSVSDLDLVESNEAFAAQALCVVRELGL--DPAKVNVNGGAIAI 345

Query: 356 GHPLGMSGARLVTTALHELEERQGRYALCTMCIGVGQGIALIIERI 401
           GHP+G SGAR++TT +HE++    +  L T+C+G G G+A+ +E +
Sbjct: 346 GHPIGASGARILTTLVHEMKRSGAKKGLATLCVGGGMGVAMCVEAV 391


Lambda     K      H
   0.319    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 419
Number of extensions: 17
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 391
Length adjustment: 31
Effective length of query: 370
Effective length of database: 360
Effective search space:   133200
Effective search space used:   133200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory