Align Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized)
to candidate CCNA_00075 CCNA_00075 3-ketoacyl-CoA thiolase
Query= SwissProt::Q8VPF1 (401 letters) >FitnessBrowser__Caulo:CCNA_00075 Length = 401 Score = 259 bits (661), Expect = 1e-73 Identities = 171/420 (40%), Positives = 235/420 (55%), Gaps = 43/420 (10%) Query: 4 EVYICDAVRTPIGRF--GGSLAAVRADDLAAVPVKALVERNPQVDWSQLDEVYLGCANQA 61 + YI DAVRTP G+ GSL A LA ++AL +RN +D S++D+V LGC + Sbjct: 3 DAYIFDAVRTPRGKGKKDGSLHETTALSLATQVLEALRDRNG-LDTSKVDDVVLGCVSPV 61 Query: 62 GEDNRNVARMALLLAGLPDSVPGVTLNRLCASGMDAVGTAFRAIASGEAELVIAGGVESM 121 GE ++AR A+L A +SV GV +NR CASG++AV A +ASGEA L I GGVESM Sbjct: 62 GEQGSDIARTAVLTADYAESVAGVQINRFCASGLEAVNMAAAKVASGEAGLAIGGGVESM 121 Query: 122 SRAPYVMGKADSAFGRGQKIEDTTIGWRFINPLMKAQYGVDAMPETADNVADDYKVSRAD 181 SR P MG A+ T A GV +AD +A Y SR D Sbjct: 122 SRVP--MGSDGGAWPTDPSSAFKT---------YFAPQGV-----SADLIATLYGFSRDD 165 Query: 182 QDAFALRSQQLAGRAQAAGYFAEEIVPVVIKGKKGETVVDADEHLRPDTTLEALAKLKP- 240 DA+A+ SQ+ A A A F + ++PV K + G T++D DE +R TT++ LA L P Sbjct: 166 VDAYAVESQKRAAAAWADNRFKKSVIPV--KDQLGLTLLDHDETVRGSTTMQTLASLNPS 223 Query: 241 -------------------VNGPDKTVTAGNASGVNDGSVALILASAEAVKKHGLKARAK 281 V + AGN+SG+ DG+ +++ + E + GLKARA+ Sbjct: 224 FTGMGEMAFDAVVTQRYPQVERVNHVHHAGNSSGIVDGAAGVLIGTKEMGEALGLKARAR 283 Query: 282 VLGMASAGVAPRVMGIGPVPAVRKLLERLNLSVADFDVIELNEAFAAQGLAVTRELGIAD 341 + G AS G P +M GP KLL++L + V D D+ ELNEAFA+ L + + L I Sbjct: 284 IKGAASIGSEPSIMLTGPALVSEKLLKKLGMEVKDIDLYELNEAFASVVLRMMQALDIPH 343 Query: 342 DDARVNPNGGAIALGHPLGASGARLVLTAVHQLEKSGGQRGLCTMCVGVGQGVALAVERV 401 D ++N NGGAIA+GHPLGA+GA ++ T + +LE+S + L T+CVG G G A +ERV Sbjct: 344 D--KMNVNGGAIAMGHPLGATGAMILGTVLDELERSDKETALITLCVGAGMGTATVIERV 401 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 401 Length adjustment: 31 Effective length of query: 370 Effective length of database: 370 Effective search space: 136900 Effective search space used: 136900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory