Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate CCNA_03483 CCNA_03483 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >FitnessBrowser__Caulo:CCNA_03483 Length = 314 Score = 89.7 bits (221), Expect = 6e-23 Identities = 70/225 (31%), Positives = 113/225 (50%), Gaps = 19/225 (8%) Query: 3 TNILKVQQLSVAYG-GIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVE 61 T+I+ VQ L+ Y G QA+K IDL++ +GE+ L+G NGAGKTT + I G + S + Sbjct: 8 TSIISVQGLTKTYASGHQALKRIDLDIRQGEIFALLGPNGAGKTTLISIICGIVNPS--Q 65 Query: 62 GHIEYLGQPLKGKKSFELVKDKLAMVPEG------RGVFTRMSIQENLLMGAYTSDDKGQ 115 G I G + + + + K+ +VP+ V+ +S L Q Sbjct: 66 GVILADGHDVV--RDYRAARTKIGLVPQELHTDAFETVWATVSFSRGLFGKPRNDALIEQ 123 Query: 116 IAADIDKWFAVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIM 175 I D+ W K+ + MA LSGG ++ + +A+AL P +L LDEP+ G+ + Sbjct: 124 ILRDLSLWD------KKDSKIMA--LSGGMKRRVMIAKALSHEPTILFLDEPTAGVDVEL 175 Query: 176 VEKIFEVIRNVSAQGITILLVEQNAKLALEAAHRGYVMESGLITM 220 ++E++R + G+TI+L + A E A R V+ G I + Sbjct: 176 RRDMWEMVRKLRESGVTIILTTHYIEEAEEMADRIGVINKGEIIL 220 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 314 Length adjustment: 25 Effective length of query: 216 Effective length of database: 289 Effective search space: 62424 Effective search space used: 62424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory