GapMind for catabolism of small carbon sources

 

Aligments for a candidate for davT in Caulobacter crescentus NA1000

Align 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 (characterized)
to candidate CCNA_00620 CCNA_00620 acetylornithine aminotransferase/succinyldiaminopimelate aminotransferase

Query= SwissProt::P22256
         (426 letters)



>lcl|FitnessBrowser__Caulo:CCNA_00620 CCNA_00620 acetylornithine
           aminotransferase/succinyldiaminopimelate
           aminotransferase
          Length = 392

 Score =  193 bits (491), Expect = 7e-54
 Identities = 129/393 (32%), Positives = 199/393 (50%), Gaps = 43/393 (10%)

Query: 29  RAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTC--FQVLAYEPY 86
           R E C ++D +GR+YLD A G+AV   GH  P++V A++ Q   L H    +++ A E  
Sbjct: 17  RGEGCWLYDQDGRDYLDLAAGVAVNTLGHGDPRLVQALKTQADILWHASNLYRLPAQEA- 75

Query: 87  LELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIAR------AATKRSGTIAFSGAYHG 140
                +  +     FA +     +G+EAVE A+K AR         +R   + F  A+HG
Sbjct: 76  -----LATKLTDATFADRVFFANSGAEAVEAAIKTARRWQGAKGRPERYRVLTFGNAFHG 130

Query: 141 RTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISEDDAIASIHRIFKNDAAPEDI 200
           RT  T++ T ++       G  P  +Y A    P + I  + A  +I             
Sbjct: 131 RTLATISATDQMKVRE---GFTP--LYDAFDTTPFNDI--EGAARAI---------TPQT 174

Query: 201 AAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVA 260
           AAI++EP+QGEGG   ++P F+  LRALCD+H ++LI DEVQ+G GRTG LFA E  GV 
Sbjct: 175 AAILVEPIQGEGGLTPATPGFLAGLRALCDQHDLLLILDEVQTGIGRTGHLFAHELYGVR 234

Query: 261 PDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAGNPIACVAALEVLKVFEQENL 320
           PD+   AK + GGFP+       +    + PG  G TY GNP+AC  A  VL        
Sbjct: 235 PDIIAVAKGLGGGFPIGACLATEDAASGMTPGSHGSTYGGNPLACAVASAVLDAVLAPGF 294

Query: 321 LQKANDLGQKLKDGLLAIAEKHPEI-GDVRGLGAMIAIELFEDGDHNKPDAKLTAEIVAR 379
           L+   +    +   L  +  +H ++    +G G M  +++       +  A+   ++VA 
Sbjct: 295 LETVRERAALVDALLERLLRRHSDLFVRAQGHGLMRGLQV-------RASAR---DVVAH 344

Query: 380 ARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQ 412
            RD G++ ++ G   +V+R+L PLTI + +I +
Sbjct: 345 LRDFGVMTVAAGA--DVVRLLPPLTISELEIAE 375


Lambda     K      H
   0.320    0.137    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 393
Number of extensions: 21
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 426
Length of database: 392
Length adjustment: 31
Effective length of query: 395
Effective length of database: 361
Effective search space:   142595
Effective search space used:   142595
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory