Align BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized)
to candidate CCNA_02751 CCNA_02751 ABC transporter ATP-binding protein
Query= TCDB::Q9RQ06 (407 letters) >FitnessBrowser__Caulo:CCNA_02751 Length = 332 Score = 171 bits (432), Expect = 4e-47 Identities = 83/222 (37%), Positives = 140/222 (63%), Gaps = 1/222 (0%) Query: 48 NFEINEGEIFVIMGLSGSGKSTLLRLLNRLIEPTSGKIFIDDQDVATLNKEDLLQVRRKS 107 + + GE+F ++G SG+GKSTL+RL+N L P++G++ +D DVA L L +RR+ Sbjct: 23 SLSVKAGEVFGVIGASGAGKSTLIRLINGLETPSAGQVIVDGDDVAALGVAGLRALRRR- 81 Query: 108 MSMVFQNFGLFPHRTILENTEYGLEVQNVPKEERRKRAEKALDNANLLDFKDQYPKQLSG 167 + M+FQ+F L +T+ +N + L++ P E + R + L+ L +YP QLSG Sbjct: 82 VGMIFQHFNLLSGKTVAQNVAFPLKLAGRPAAEVKARTAELLERVGLSAHAGKYPAQLSG 141 Query: 168 GMQQRVGLARALANDPEILLMDEAFSALDPLIRREMQDELLELQAKFQKTIIFVSHDLNE 227 G +QRVG+ARALA +P++LL DEA SALDP ++ D + L + TI+ ++H+++ Sbjct: 142 GQKQRVGIARALATNPKVLLCDEATSALDPETTEQILDLIAGLNRELGLTIVLITHEMDV 201 Query: 228 ALRIGDRIAIMKDGKIMQIGTGEEILTNPANDYVKTFVEDVD 269 R+ DR+A++ G++++ G EE+ +PA+D + FV + + Sbjct: 202 VRRVCDRVAVLDAGRVVEEGAVEEVFLHPASDTARRFVREAE 243 Lambda K H 0.316 0.135 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 407 Length of database: 332 Length adjustment: 30 Effective length of query: 377 Effective length of database: 302 Effective search space: 113854 Effective search space used: 113854 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory