GapMind for catabolism of small carbon sources

 

Aligments for a candidate for proP in Caulobacter crescentus NA1000

Align proline porter II (characterized)
to candidate CCNA_00025 CCNA_00025 major facilitator superfamily transporter

Query= CharProtDB::CH_024324
         (500 letters)



>lcl|FitnessBrowser__Caulo:CCNA_00025 CCNA_00025 major facilitator
           superfamily transporter
          Length = 550

 Score =  197 bits (500), Expect = 1e-54
 Identities = 120/334 (35%), Positives = 182/334 (54%), Gaps = 22/334 (6%)

Query: 23  LRKAITAASLGNAMEWFDFGVYGFVAYALGKVFFPGADPSVQMVAALATFSVPFLIRPLG 82
           +R  ++A+S G A EW+DF ++G +   + K FF G + +   +AALA F V F  RPLG
Sbjct: 11  MRTVVSASSAGTAFEWYDFFIFGSLTQVISKTFFAGLNETAGYIAALALFGVGFAFRPLG 70

Query: 83  GLFFGMLGDKYGRQKILAITIVIMSISTFCIGLIPSYDTIGIWAPILLLICKMAQGFSVG 142
            L FG +GD+ GR+     T+++M  +TF I  +P+Y+  GI APILL+I +  QGF++G
Sbjct: 71  ALVFGKIGDQDGRKGAFLATVLLMGGATFAIAFLPTYEQAGIIAPILLIILRCLQGFALG 130

Query: 143 GEYTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGAGVVVL-----ISTIVGEANFLD 197
           GEY GA+I+VAE+SP  KRG+  SW+   +  G + GA +V+L     +   VG   F +
Sbjct: 131 GEYGGAAIYVAEHSPANKRGWATSWVQTSAAFG-LFGALLVILATRWVLGKYVGPDAFDE 189

Query: 198 WGWRIPFFIALPLGIIGLYLRHALEETPAFQQHVDKLEQGDREGLQDGPKVSFKEIATKY 257
           WGWRIPF ++L L  I +++R  L E+P F       E    EG     K  + E A   
Sbjct: 190 WGWRIPFAVSLGLLGISVWMRLKLTESPTF-------EAMKAEG--QASKAPYAE-AFGQ 239

Query: 258 WRSL----LTCIGLVIATNVTYYMLLTYMPSYLSHNLHYSE-DHGVLIIIAIMIGMLFVQ 312
           W +L    L  + ++ A    +Y    Y+ +++   L         L++IA  +  +F  
Sbjct: 240 WSNLKLVILAFVSMMCAQGAVWYTSFFYVQTFMEKFLKVDPVTINELMMIATAVSAIF-Y 298

Query: 313 PVMGLLSDRFGRRPFVLLGSVALFVLAIPAFILI 346
            V G LSD+ GR+P +L G     +   P F L+
Sbjct: 299 VVFGWLSDKVGRKPVMLGGMTLALLFYFPGFHLL 332



 Score = 43.5 bits (101), Expect = 2e-08
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 353 LIFAGLLMLAVILNCFTGVMASTLPAMFPTHIRYSALAAAFNISV-LVAGLTPTLAAWLV 411
           +I   L +  +      G +A+ L  +FPT +RY+AL+  ++I    V G  P  A  +V
Sbjct: 454 MILGVLFVFVIAATALFGPLAACLVELFPTRVRYTALSLPYHIGTGWVGGFVPFFAFAIV 513

Query: 412 ESSQNLMMPAYYLMVVAVVGLITGV-TMKETANRPL 446
            +  N+    +Y     ++ ++T +  + ET  RPL
Sbjct: 514 AAVGNIYAGLWYPFAFTLLSVLTTLFLLPETKERPL 549


Lambda     K      H
   0.327    0.142    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 632
Number of extensions: 32
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 500
Length of database: 550
Length adjustment: 35
Effective length of query: 465
Effective length of database: 515
Effective search space:   239475
Effective search space used:   239475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory