Align Glycine betaine/proline/ectoine/pipecolic acid transporter OusA; Osmoprotectant uptake system A (characterized)
to candidate CCNA_01031 CCNA_01031 transporter, major facilitator superfamily
Query= SwissProt::Q47421 (501 letters) >FitnessBrowser__Caulo:CCNA_01031 Length = 550 Score = 215 bits (547), Expect = 4e-60 Identities = 118/329 (35%), Positives = 185/329 (56%), Gaps = 8/329 (2%) Query: 22 GRLRKAITAAALGNAMEWFDFGVYGFVAYALGQVFFPGADPGVQMIAALATFSVPFLIRP 81 GR + A++LG EW+DF +YG +A + FF G + I AL F+ F IRP Sbjct: 12 GRDTMVVGASSLGTVFEWYDFYLYGSLAPIITSHFFSGVNETTGFILALLAFAAGFAIRP 71 Query: 82 LGGVFFGALGDKYGRQKILAITIIIMSISTFCIGLIPSYERIGIWAPILLLLAKMAQGFS 141 LG + FG LGD +GR+ IT+++M +STF +GL+PSY +IG+ API L+L ++ QG + Sbjct: 72 LGALIFGRLGDLWGRKNTFLITMLLMGVSTFVVGLLPSYAQIGVAAPIALVLMRLVQGLA 131 Query: 142 VGGEYTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGAGVVVLISTLIGEQAFLAWGW 201 +GGEY GA+ +VAE++P KRGF SW+ + G L V+++ +GE+AF AWGW Sbjct: 132 LGGEYGGAATYVAEHAPPGKRGFYTSWIQTTATIGLFLSLAVILVARIQLGEEAFKAWGW 191 Query: 202 RLPFFLALPLGLIGLYLRHALEETPAFRQHVEKLEQNDRDGLKAGPGVSFREIATHHWKS 261 R+PF ++L L + L++R L E+P F + + + + + + +A +I Sbjct: 192 RIPFLVSLLLLGVSLWIRLKLHESPTFERMIAEGKGSKKPLTEAFGNWPNLKIV------ 245 Query: 262 LLVCIGLVIATNVTYYMLLTYMPSYLSHSLHY-SENHGVLIIIAIMIGMLFVQPVMGLLS 320 LL +GL + V +Y Y +L +L L+ +A++IG F + G LS Sbjct: 246 LLALVGLTMGQAVVWYTGQFYALFFLEKTLKLDGALANTLVAVALLIGTPFF-VICGWLS 304 Query: 321 DRFGRKPFVVIGSVAMFFLAVPSFMLINS 349 D+ GRKP +++G + P F I + Sbjct: 305 DKIGRKPIIILGCLLAALTYFPIFKAITT 333 Score = 53.1 bits (126), Expect = 2e-11 Identities = 34/95 (35%), Positives = 58/95 (61%), Gaps = 3/95 (3%) Query: 357 LGLLMLAVI-LNAFTGVMASTLPALFPTHIRYSALASAFNI-SVLIAGLTPTVAAWLVES 414 +GLL L VI + G +A+ L LFPT IRY+A++ ++I + G PT A +V + Sbjct: 455 IGLLALLVIYVTMVYGPIAAMLVELFPTRIRYTAMSLPYHIGNGWFGGFLPTTAFAIVAA 514 Query: 415 SQNLYMPAYYLMVIAVI-GLLTGLFMKETANKPLK 448 + ++Y +Y ++IA I ++ GLF+K+T + L+ Sbjct: 515 TGDIYSGLWYPVIIAAITAVVGGLFLKDTRHNRLE 549 Lambda K H 0.327 0.142 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 655 Number of extensions: 30 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 501 Length of database: 550 Length adjustment: 35 Effective length of query: 466 Effective length of database: 515 Effective search space: 239990 Effective search space used: 239990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory