GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpE in Caulobacter crescentus NA1000

Align propionate-CoA ligase (EC 6.2.1.17); 3-hydroxypropionyl-CoA synthase (EC 6.2.1.36) (characterized)
to candidate CCNA_01017 CCNA_01017 acyl-CoA synthetase

Query= BRENDA::A4YGR1
         (661 letters)



>lcl|FitnessBrowser__Caulo:CCNA_01017 CCNA_01017 acyl-CoA synthetase
          Length = 530

 Score =  133 bits (334), Expect = 2e-35
 Identities = 156/532 (29%), Positives = 230/532 (43%), Gaps = 59/532 (11%)

Query: 108 ERKIVTYQDMFYEVNRWANALRSLGVGKGDRVTIYMPLTPEGIAAMLASARIGAIHSVIF 167
           E +  T+  +    N+ ANAL + G+  GDR+      +      +L +A+ G + + I 
Sbjct: 33  EGRETTFAQLDRHTNQVANALLAAGLSTGDRIAYVGKNSDHYFELLLGAAKAGVVTTPIG 92

Query: 168 AGFGSQAIADRVEDAKAKVVITADAYPRRGKVVELKKTVDEALNSLGERSPVQHVLVYRR 227
               +  IA  V D++AK+V             EL   VD     L  R  V  + +   
Sbjct: 93  WRLAAPEIAYIVGDSEAKLVFVGR---------ELIGHVDAVAAELTHRPVV--IAMEAE 141

Query: 228 MKTDVNMKEG-RDVFFDEVGKYRYVEPER-MDSNDPLFILYTSGTTGKPKGIM---HSTG 282
              D    EG RD   D       V+P + +  +D    LYTSGTTG+PKG M   H+  
Sbjct: 142 GAGDYQTFEGWRDAASD-------VDPHKPIQISDIAIQLYTSGTTGRPKGAMLTHHNLL 194

Query: 283 GYLTGTAVMLL-WS-YGLSQENDVLFNTSDIG---W-IVGHSYITYSPLIMGRTVVIYES 336
           G     A   L W+ +G S  + V    + IG   W +VG        LI G   V+   
Sbjct: 195 GMRREAAKNPLEWNQWGPSDVSLVAMPVAHIGGTGWGLVG--------LINGAKGVVARE 246

Query: 337 APDYPYPDKWAEIIERYRATTFGTSATALRYFMKYGDEYVKNHDLSSIRIIVTNGEVLNY 396
                 P K  + IE+ R +       AL+  ++      +  D S +  I+     +  
Sbjct: 247 FD----PTKVLDFIEKDRISKMFMVPAALQIVVRL--PRAREVDYSRLTHILYGAAPIPL 300

Query: 397 SPWKWGLEVLGGGKVFMSHQWWQTETGAPNLGYLPGIIYMPM--KSGPASGFPLPGNFVE 454
              +  +EV G G V    Q+  TET    + YLP   + P   K   A+G P+PG  ++
Sbjct: 301 DLLRECMEVFGCGFV---QQYGMTETTG-TVVYLPPEDHDPAGNKRMRAAGLPMPGVELK 356

Query: 455 VLDENGNPSAPRVRGYLVMRPPFPPNMMMGMWNDNGERLKKTYFSKFGSLYYPGDFAMVD 514
           ++DE G    P   G + +R       M G W  + E   KT  +        GD   +D
Sbjct: 357 IIDEAGKSLPPNTVGEVAVRSSAN---MAGYWKLD-EATAKTMDAD--GWLRTGDAGYLD 410

Query: 515 EDGYIWVLGRADETLKIAAHRIGAGEVESAITSHPSVAEAAVIGVPDSVKGEEVHAFVVL 574
           EDGY+++  R  + +      I   EVESA+  HP VAE AVIGVPD   GE V A V  
Sbjct: 411 EDGYLFIHDRVKDMIISGGENIYPAEVESAVYGHPHVAEVAVIGVPDDKWGEAVKAVVAP 470

Query: 575 KQGYAPSSELAKDIQSHVRKVMGPIVSPQ-IHFVDKLPKTRSGKVMRRVIKA 625
           K G  P    A DI +  R  +    +P+ + F+  LP+  SGK++RR ++A
Sbjct: 471 KPGVTPD---ADDIIAFARTRIAHFKAPKSVDFIPALPRNASGKILRRELRA 519


Lambda     K      H
   0.318    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 876
Number of extensions: 48
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 661
Length of database: 530
Length adjustment: 37
Effective length of query: 624
Effective length of database: 493
Effective search space:   307632
Effective search space used:   307632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory