Align Sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate CCNA_01885 CCNA_01885 short chain dehydrogenase
Query= reanno::WCS417:GFF2259 (257 letters) >FitnessBrowser__Caulo:CCNA_01885 Length = 258 Score = 157 bits (396), Expect = 3e-43 Identities = 98/254 (38%), Positives = 144/254 (56%), Gaps = 14/254 (5%) Query: 3 RLEGKSALITGSARGIGRAFAQAYIAEGATVAIADIDLQRAQATAAEL---GPQAYAVAM 59 RLEG+ A +TG++RG+GRA A AEGA VA+ D+ AQA A E+ G +A + Sbjct: 10 RLEGRVAAVTGASRGLGRATAALLAAEGAMVALLDLKAHWAQAAADEIIAAGGKAVGLGC 69 Query: 60 DVTDQASIDGAITAVVAQAGKLDILINNAALFDLAPIVDITRDSYDRLFSINVAGTLFTL 119 DV+D+ ++ + AV G+ D+L+NNA P+ I +S DR+ S+ +G ++ + Sbjct: 70 DVSDREALTATLGAVNDAHGRFDVLVNNAMWNVYEPLAAIRPESLDRMVSVGFSGVIWGM 129 Query: 120 QAAARQMIRQGHGGKIINMASQAGRRGEPLVAIYCATKAAVISLTQSAGLNLIKQGINVN 179 QAAA M G GG I+N+AS + + G P YC KA V +T++A L I VN Sbjct: 130 QAAAPLMAASG-GGSIVNIASVSAQLGIPNGIAYCGVKAGVAGMTRAAAAELGAMNIRVN 188 Query: 180 AIAPGVVDGEHWDGVDALFAKHEGLAPGEKKQRVGAEVPFGRMGTAEDLTGMAIFLASKE 239 A+AP VD E GV + ++ E +A R+G + P GR+GT ED+ +LA + Sbjct: 189 AVAPSTVDTE---GVRRVVSE-ERIA-----MRIG-QTPLGRLGTTEDIAKAVRYLACDD 238 Query: 240 ADYVVAQTYNVDGG 253 +D+V Q VDGG Sbjct: 239 SDFVTGQMLTVDGG 252 Lambda K H 0.318 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 258 Length adjustment: 24 Effective length of query: 233 Effective length of database: 234 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory