Align Fructose import permease protein FruG (characterized)
to candidate CCNA_00904 CCNA_00904 inositol ABC transport system, permease protein IatP
Query= SwissProt::Q8G845 (340 letters) >FitnessBrowser__Caulo:CCNA_00904 Length = 332 Score = 132 bits (333), Expect = 9e-36 Identities = 95/306 (31%), Positives = 160/306 (52%), Gaps = 22/306 (7%) Query: 30 VIFILMIIMGQALFGT----YIRLGFISSLFIDHAYLIILAVAMTLPILTGGIDLSVGAI 85 ++F+L+++ A+FG ++ ++ + + I+AV MT IL GGID++VG++ Sbjct: 29 ILFLLLLV---AVFGAANERFLTARNALNILSEVSIYGIIAVGMTFVILIGGIDVAVGSL 85 Query: 86 VAITAVVGLKLANAGV---PA--FLVMIIMLLIGAVFGLLAGTLIEEFNMQPFIATLSTM 140 +A ++ + A V PA + +++ LIG G + G + ++ FI TL M Sbjct: 86 LAFASIAAAYVVTAVVGDGPATWLIALLVSTLIGLAGGYVQGKAVTWLHVPAFIVTLGGM 145 Query: 141 FLARGLASIISTDSLTFPQGNDFSFISNVIKIIDNPKISNDLSFNVGVIIALVVVVFGYV 200 + RG +++ G S ++ + + +I L V V+I +V G+V Sbjct: 146 TVWRGATLLLN-------DGGPISGFNDAYRWWGSGEI---LFLPVPVVIFALVAAAGHV 195 Query: 201 FLHHTRTGRTIYAIGGSRSSAELMGLPVKRTQYIIYLTSATLAALASIVYTANIGSAKNT 260 L +TR GR +YA+GG+ +A L G+ V +Y LA L+ + +A +GSA+ Sbjct: 196 ALRYTRYGRQVYAVGGNAEAARLSGVNVDFITTSVYAIIGALAGLSGFLLSARLGSAEAV 255 Query: 261 VGVGWELDAVASVVIGGTIITGGFGYVLGSVLGSLVRSILDPLTSDFGVPAEWTTIVIGL 320 G G+EL +ASVVIGG +TGG G V G+VLG+L+ +L V + +VIGL Sbjct: 256 AGTGYELRVIASVVIGGASLTGGSGGVGGTVLGALLIGVLSNGLVMLHVTSYVQQVVIGL 315 Query: 321 MILVFV 326 +I+ V Sbjct: 316 IIVAAV 321 Lambda K H 0.327 0.142 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 332 Length adjustment: 28 Effective length of query: 312 Effective length of database: 304 Effective search space: 94848 Effective search space used: 94848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory