Align High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate CCNA_03235 CCNA_03235 spermidine/putrescine transport ATP-binding protein potA
Query= TCDB::P21630 (233 letters) >FitnessBrowser__Caulo:CCNA_03235 Length = 381 Score = 107 bits (266), Expect = 4e-28 Identities = 70/230 (30%), Positives = 127/230 (55%), Gaps = 7/230 (3%) Query: 1 MLSFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRY 60 +++F+ V+ +GK+ A+ +VS+ V +GE L+G +G GK+TLL L G G I Sbjct: 14 IITFENVTKRFGKLAAVDNVSLTVNEGEFFALLGPSGCGKTTLLRMLAGFETPTEGRILI 73 Query: 61 EGEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLAMGGFFTD--KDDYQVQMDKVLE 118 +G+++ +P + ++ + +V + VF +TV +N+A G + K + + ++ + LE Sbjct: 74 DGQDISNVPPN---KRPVNMVFQSYAVFPHMTVADNVAYGLKVDNVPKAEREARVAEALE 130 Query: 119 LFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGL-APIIIQQIFEIIE 177 L +L ++ +SGG++Q +A+ RAL+ +P++LLLDEP L A + Q E+ Sbjct: 131 LV-QLGGLGGRKPDQLSGGQRQRVALARALVKRPRVLLLDEPLSALDAKLREQMRTELCT 189 Query: 178 QLRREGVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVR 227 + G+T +V + ++AL LA R V+ G + T + L P R Sbjct: 190 LQEKVGITFIMVTHDQDEALALASRCAVMSKGLLQQVATPSDLYEFPNSR 239 Lambda K H 0.318 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 381 Length adjustment: 26 Effective length of query: 207 Effective length of database: 355 Effective search space: 73485 Effective search space used: 73485 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory