GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dddA in Caulobacter crescentus NA1000

Align 3-hydroxypropionate dehydrogenase (EC 1.1.1.59) (characterized)
to candidate CCNA_01337 CCNA_01337 GMC family oxidoreductase

Query= metacyc::MONOMER-15202
         (579 letters)



>lcl|FitnessBrowser__Caulo:CCNA_01337 CCNA_01337 GMC family
           oxidoreductase
          Length = 540

 Score =  577 bits (1487), Expect = e-169
 Identities = 297/552 (53%), Positives = 375/552 (67%), Gaps = 15/552 (2%)

Query: 26  MADQTNNTHAFDYIVVGAGTAGCLLANRLSADPANRVLLIEAGGRDNYHWIHIPVGYLYC 85
           M D+  +   +DYIVVGAG+AGCLLANRLSADP  RVLL+EAGG DN+ W H+PVGYL+ 
Sbjct: 1   MGDEAIHLGDYDYIVVGAGSAGCLLANRLSADPRRRVLLLEAGGDDNWIWFHVPVGYLFA 60

Query: 86  INNPRTDWRFRTEPDPGLNGRSLIYPRGKTLGGCSSINGMLYLRGQARDYDGWAELTGDD 145
           I NPR DW   T P  GL+GR L YPRGK +GG S+IN M+Y+RGQARDYDGW +  G  
Sbjct: 61  IGNPRADWMLETTPQAGLDGRVLAYPRGKVIGGSSAINAMIYMRGQARDYDGWRQ-RGLA 119

Query: 146 AWRWDNCLPDFMRHEDHYRLDEGGDADPDHYKFHGHGGEWRIEKQRLKWQVLADFATAAV 205
            W W + LP F++HEDH  +D  G+        H  GGE+R+E  R++W VL     A  
Sbjct: 120 GWGWPDVLPYFLKHEDH--IDPRGE-------HHRAGGEYRVEHPRVRWDVLDAIRRAGE 170

Query: 206 EAGVPRTRDFNRGDNEGVDAFEVNQRSGWRWNASKAFLRGVEQRGNLTVWHSTQVLKLDF 265
           +AG+ +  DFN GDN G   F+VNQR+G RW+ + AFL+ V  R NL +    +V +L  
Sbjct: 171 QAGIAQVDDFNGGDNAGSSYFQVNQRAGRRWSTATAFLKPVLSRPNLRLVKGVEVERLII 230

Query: 266 ASGEGSEPRCCGVTVERAGKKVVTTARCEVVLSAGAIGSPQLLQLSGIGPTALLAEHAIP 325
              +G   R  G+   R G  V  +   E++L+AGAIGSP +LQ SGIG    L+   + 
Sbjct: 231 ---DGKRVR--GLRGRRGGAAVTASVSGELILAAGAIGSPVILQRSGIGRGETLSRAGVA 285

Query: 326 VVADLPGVGENLQDHLQIRSIYKVKGAKTLNTMANSLIGKAKIGLEYILKRSGPMSMAPS 385
           +V DLPGVG NLQDHLQIR ++KV G +TLNT   +L  +A +GL+Y+L+RSGP++MAPS
Sbjct: 286 MVHDLPGVGANLQDHLQIRPVFKVSGVRTLNTDYANLFRRAGMGLDYLLRRSGPLTMAPS 345

Query: 386 QLCIFTRSSKEYEHPNLEYHVQPLSLEAFGQPLHDFPAITASVCNLNPTSRGTVRIKSGN 445
           QL +F RS  EYE  NLE+H QPLSL+ +G+ LH F A+TASVCNL P+SRG V +    
Sbjct: 346 QLGMFCRSGPEYESANLEFHFQPLSLDRWGEGLHRFGAVTASVCNLRPSSRGAVSLSGPG 405

Query: 446 PRQAPAISPNYLSTEEDRQVAADSLRVTRHIASQPAFAKYDPEEFKPGVQYQSDEDLARL 505
              +P I PNYL+TEEDR+VA +SL+  R I  Q A A Y PE F+PG +   D  L   
Sbjct: 406 LEHSPRIDPNYLATEEDRRVAVESLKWARRIMGQAALAAYAPEAFRPGPEVDGDAALLAA 465

Query: 506 AGDIGTTIFHPVGTAKMGRDDDPMAVVDSHLRVRGVTGLRVVDASIMPTITSGNTNSPTL 565
           A  + TTIFHPVGTA MG D DP+AV+D+ LRVRGV GLRV+DAS MPTITSGNTN+PT+
Sbjct: 466 AKALATTIFHPVGTAAMGADGDPLAVLDARLRVRGVEGLRVIDASAMPTITSGNTNAPTV 525

Query: 566 MIAEKAAGWILK 577
           MIAEK A  IL+
Sbjct: 526 MIAEKGAAMILE 537


Lambda     K      H
   0.318    0.135    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 984
Number of extensions: 42
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 579
Length of database: 540
Length adjustment: 36
Effective length of query: 543
Effective length of database: 504
Effective search space:   273672
Effective search space used:   273672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory