Align palmitoyl-CoA hydrolase (EC 3.1.2.2) (characterized)
to candidate CCNA_02600 CCNA_02600 S-formylglutathione hydrolase
Query= BRENDA::P33018 (278 letters) >FitnessBrowser__Caulo:CCNA_02600 Length = 277 Score = 278 bits (711), Expect = 9e-80 Identities = 141/277 (50%), Positives = 185/277 (66%), Gaps = 3/277 (1%) Query: 1 MEMLEEHRCFEGWQQRWRHDSSTLNCPMTFSIFLPPPRDHTPPPVLYWLSGLTCNDENFT 60 +E L HR G + RHDS++ PM F++++P + P P L WLSGLTC ++NFT Sbjct: 3 VETLSTHRVHGGTLRYCRHDSTSTGTPMKFTVWIPDGQG--PFPYLVWLSGLTCTEDNFT 60 Query: 61 TKAGAQRVAAELGIVLVMPDTSPRGEKVANDDGYDLGQGAGFYLNATQPPWATHYRMYDY 120 K+G AA GI +V PDTSPRGE VA+D YDLGQGAGFY++ATQ PWA H+ M+ Y Sbjct: 61 VKSGVYEHAARHGIAIVAPDTSPRGEGVADDPAYDLGQGAGFYVDATQAPWAPHFMMHSY 120 Query: 121 LRDELPALVQSQFNVSD-RCAISGHSMGGHGALIMALKNPGKYTSVSAFAPIVNPCSVPW 179 + +L A V+ F + R I GHSMGGHGAL +ALK+P + SVSAF+PIV+P + PW Sbjct: 121 VTGDLLAAVEGAFPLDGARKGIFGHSMGGHGALTIALKHPELFKSVSAFSPIVSPLNCPW 180 Query: 180 GIKAFSSYLGEDKNAWLEWDSCALMYASNAQDAIPTLIDQGDNDQFLADQLQPAVLAEAA 239 G KA ++YLG D+ AW +D+CAL+ LIDQG D FL +QL+P ++ AA Sbjct: 181 GDKALTAYLGPDRAAWRPYDACALIEDGKGASFDDILIDQGLADSFLENQLKPQLIEAAA 240 Query: 240 RQKAWPMTLRIQPGYDHSYYFIASFIEDHLRFHAQYL 276 + +T+R Q GYDHSY+FI++FI DHL FHAQ L Sbjct: 241 AKAGRKVTVRRQDGYDHSYFFISTFIGDHLAFHAQRL 277 Lambda K H 0.320 0.136 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 277 Length adjustment: 25 Effective length of query: 253 Effective length of database: 252 Effective search space: 63756 Effective search space used: 63756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory