GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lpd in Caulobacter crescentus NA1000

Align dihydrolipoyl dehydrogenase (EC 1.8.1.4) (characterized)
to candidate CCNA_00346 CCNA_00346 dihydrolipoamide dehydrogenase

Query= BRENDA::A0A0H2ZHZ0
         (467 letters)



>lcl|FitnessBrowser__Caulo:CCNA_00346 CCNA_00346 dihydrolipoamide
           dehydrogenase
          Length = 466

 Score =  643 bits (1658), Expect = 0.0
 Identities = 311/465 (66%), Positives = 377/465 (81%)

Query: 2   MESYDVIVIGAGPGGYNAAIRAGQLGLKVACVEGRETLGGTCLNVGCMPSKALLHASELY 61
           M  YDV++IG GPGGYNAAIRAGQLGLKVA VEGR  LGGTCLNVGCMPSKALLHASELY
Sbjct: 1   MAQYDVVIIGGGPGGYNAAIRAGQLGLKVAIVEGRGKLGGTCLNVGCMPSKALLHASELY 60

Query: 62  AAASGGEFARLGIRVSPELDLAQMMKQKDESVAALTRGVEFLFRKHKVQWIKGWARLQGE 121
           AAA+G EFA+LGI V P+L+L+QMM QK ESV ALT+GVEFL +K+KV+++KGW R+ G 
Sbjct: 61  AAATGPEFAKLGIEVKPKLNLSQMMAQKAESVEALTKGVEFLMKKNKVEYVKGWGRIDGV 120

Query: 122 GRVGVALADGGHAQLEARDIVIATGSEPAPLPGVPVDNQRILDSTGALELAEVPRHLVVI 181
           G+V V   DG    LE ++IVIATGSEP PLPGV VDN+RI+DSTGAL L EVP+ LVV+
Sbjct: 121 GKVVVKAEDGSETTLETKNIVIATGSEPTPLPGVSVDNKRIIDSTGALSLPEVPKRLVVV 180

Query: 182 GAGVIGLELGSVWRRLGAQVTVLEYLERICPGLDGETARTLQRALTRQGMRFRLGTRVVA 241
           GAGVIGLELGSVW+RLGA+VTV+EYL+RI PG D E A   Q+ L +QG +F+LG +V  
Sbjct: 181 GAGVIGLELGSVWKRLGAEVTVVEYLDRILPGTDTEVANAFQKILVKQGFKFQLGAKVTG 240

Query: 242 ARSGEQGVELDLQPAAGGATESLQADYVLVAIGRRPYTEGLGLETVGLASDRRGMLENQG 301
           A +G +GV+L  +P AGG  ++++ADYVLVAIGRRPYT+GLGLETVG+  D+RGM+ N  
Sbjct: 241 AEAGAKGVKLSFEPVAGGEAQTIEADYVLVAIGRRPYTQGLGLETVGVTPDKRGMIANDH 300

Query: 302 QRSAAPGVWVIGDVTSGPMLAHKAEEEAIVCIERIAGHAAEMNAEVIPSVIYTQPEVASV 361
            ++   GVWVIGDVTSGPMLAHKAE+E + CIE IAG A  +N  +IP V+YT PEVA+V
Sbjct: 301 FKTGVAGVWVIGDVTSGPMLAHKAEDEGVACIEMIAGKAGHVNYGIIPGVVYTSPEVATV 360

Query: 362 GLGEEQLQAARREYKVGRFPFSANSRAKINHESEGFIKILSDARSDQVLGVHMIGPGVSE 421
           G  E++L+A    YKVG+FPF ANSRAKINHE++GF+KIL+DA++D++LG HMIGP V +
Sbjct: 361 GKTEDELKAEGVAYKVGKFPFLANSRAKINHETDGFVKILADAKTDRILGAHMIGPNVGD 420

Query: 422 MIGEACVAMEFSASAEDLALTCHPHPTRSEALRQAAMDVHGRAMQ 466
           MI E CVAMEF  ++ED+A TCHPHPTRSEALRQAAM V G  MQ
Sbjct: 421 MIAEYCVAMEFGGASEDVARTCHPHPTRSEALRQAAMGVEGWTMQ 465


Lambda     K      H
   0.318    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 794
Number of extensions: 27
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 467
Length of database: 466
Length adjustment: 33
Effective length of query: 434
Effective length of database: 433
Effective search space:   187922
Effective search space used:   187922
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate CCNA_00346 CCNA_00346 (dihydrolipoamide dehydrogenase)
to HMM TIGR01350 (lpdA: dihydrolipoyl dehydrogenase (EC 1.8.1.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01350.hmm
# target sequence database:        /tmp/gapView.1082.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01350  [M=461]
Accession:   TIGR01350
Description: lipoamide_DH: dihydrolipoyl dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                             -----------
   1.7e-168  547.0   7.7   1.9e-168  546.8   7.7    1.0  1  lcl|FitnessBrowser__Caulo:CCNA_00346  CCNA_00346 dihydrolipoamide dehy


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Caulo:CCNA_00346  CCNA_00346 dihydrolipoamide dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  546.8   7.7  1.9e-168  1.9e-168       1     456 [.       3     461 ..       3     466 .] 0.96

  Alignments for each domain:
  == domain 1  score: 546.8 bits;  conditional E-value: 1.9e-168
                             TIGR01350   1 eydvvviGgGpgGYvaAiraaqlglkvalvek.eklGGtClnvGCiPtKalLksaevveelke..akelgiev 70 
                                           +ydvv+iGgGpgGY aAira+qlglkva+ve   klGGtClnvGC+P+KalL+++e+++ ++   +++lgiev
  lcl|FitnessBrowser__Caulo:CCNA_00346   3 QYDVVIIGGGPGGYNAAIRAGQLGLKVAIVEGrGKLGGTCLNVGCMPSKALLHASELYAAATGpeFAKLGIEV 75 
                                           69*****************************879*************************9987679*****98 PP

                             TIGR01350  71 envkldlekllerkekvvkklvgGvkaLlkknkvevikGeaklldkkevevkkekke.kkleakniiiAtGse 142
                                            + kl+l++++++k + v+ l++Gv++L+kknkve +kG +++ + ++v vk+e+++ ++le+kni+iAtGse
  lcl|FitnessBrowser__Caulo:CCNA_00346  76 -KPKLNLSQMMAQKAESVEALTKGVEFLMKKNKVEYVKGWGRIDGVGKVVVKAEDGSeTTLETKNIVIATGSE 147
                                           .79**************************************************99886899************ PP

                             TIGR01350 143 prelplkleedekvvitseealelkevpeslvivGgGviGvEfasifaklGvkvtvielldrilpaldaevsk 215
                                           p+ lp+ +++d+k++i+s++al+l+evp++lv+vG+GviG+E++s++++lG++vtv+e+ldrilp +d+ev++
  lcl|FitnessBrowser__Caulo:CCNA_00346 148 PTPLPG-VSVDNKRIIDSTGALSLPEVPKRLVVVGAGVIGLELGSVWKRLGAEVTVVEYLDRILPGTDTEVAN 219
                                           ******.999999************************************************************ PP

                             TIGR01350 216 vlkkklkkkgvkiltnakvtevekeedevv..veakkk.evetleaekvLvavGrkpnleelgleklgvelde 285
                                           + +k l k+g k+  +akvt  e+ ++ v+  +e   + e++t+ea++vLva+Gr+p +++lgle++gv+ d+
  lcl|FitnessBrowser__Caulo:CCNA_00346 220 AFQKILVKQGFKFQLGAKVTGAEAGAKGVKlsFEPVAGgEAQTIEADYVLVAIGRRPYTQGLGLETVGVTPDK 292
                                           ********************99999999995555444459********************************* PP

                             TIGR01350 286 rgaikvdeelrtnvpgiyaiGDvigklmLAhvAskegvvaaekiagkekseidykavPsviytePevasvGlt 358
                                           rg+i  +++++t v+g+++iGDv++++mLAh+A++egv ++e iagk+  +++y  +P v+yt+Peva+vG+t
  lcl|FitnessBrowser__Caulo:CCNA_00346 293 RGMI-ANDHFKTGVAGVWVIGDVTSGPMLAHKAEDEGVACIEMIAGKAG-HVNYGIIPGVVYTSPEVATVGKT 363
                                           **76.699**************************************998.9********************** PP

                             TIGR01350 359 eeqakeegievkvgkfpfaangkalaleetdGfvkvivdkktgeilGahivgaeaseliselalaveleltve 431
                                           e+++k+eg+++kvgkfpf an++a + +etdGfvk+++d kt++ilGah++g+++ ++i+e  +a+e+++ +e
  lcl|FitnessBrowser__Caulo:CCNA_00346 364 EDELKAEGVAYKVGKFPFLANSRAKINHETDGFVKILADAKTDRILGAHMIGPNVGDMIAEYCVAMEFGGASE 436
                                           ************************************************************************* PP

                             TIGR01350 432 elaktihpHPtlsEaikeaalaalg 456
                                           ++a+t+hpHPt sEa+ +aa  + g
  lcl|FitnessBrowser__Caulo:CCNA_00346 437 DVARTCHPHPTRSEALRQAAMGVEG 461
                                           *******************987765 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (461 nodes)
Target sequences:                          1  (466 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 8.68
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory