GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mcm-large in Caulobacter crescentus NA1000

Align methylmalonyl-CoA mutase (subunit 2/2) (EC 5.4.99.2) (characterized)
to candidate CCNA_03177 CCNA_03177 methylmalonyl-CoA mutase MeaA-like protein

Query= BRENDA::O74009
         (563 letters)



>lcl|FitnessBrowser__Caulo:CCNA_03177 CCNA_03177 methylmalonyl-CoA
           mutase MeaA-like protein
          Length = 662

 Score =  377 bits (969), Expect = e-109
 Identities = 213/486 (43%), Positives = 301/486 (61%), Gaps = 15/486 (3%)

Query: 87  WTMRQYAGYATAEESNKRYKYLLSQGQTGLSVAFDLPTQLGYDSDHPLAEGEVGKVGVAI 146
           W  R YAG++TAE+SN  Y+  L++GQTGLSVAFDLPTQ GYD DH LA GEVGKVGV I
Sbjct: 14  WIFRTYAGHSTAEKSNALYRANLAKGQTGLSVAFDLPTQTGYDPDHILARGEVGKVGVPI 73

Query: 147 DSLWDMRILFDGIPLDKVSTSMTINSTAANLLAMYILVAEEQGVSQEKLRGTVQNDILKE 206
             L DMR LF  IPL+K++TSMTIN+ AA LLAMY+ +A+EQG  ++ L+GT QND++KE
Sbjct: 74  SHLGDMRQLFSEIPLEKMNTSMTINAPAAWLLAMYVALADEQGADRKLLQGTTQNDLIKE 133

Query: 207 YIARGTYIFPPQPSMRLTTDIIMYCAENVPKWNPISISGYHIREAGANAVQEVAFTLADG 266
           Y++RGTYIFPP PS+RL  D+I +C   VPKWNP+++  YH++EAGA   QE+AF LA  
Sbjct: 134 YLSRGTYIFPPGPSLRLIGDMIAWCYREVPKWNPMNVCSYHLQEAGATPEQELAFALATA 193

Query: 267 IEYVKAVIERGM----DVDKFAPRLSFFFAAHNNFLEEIAKFRAARRLWAYIMKEWFNAK 322
           I  +  V   G     D +  A R+SFF  A   F+ E+ K R+  +LW  I+ E +  +
Sbjct: 194 ISVLDTVKAGGQVPDEDFEIVASRISFFVNAGVRFVTELCKMRSFTKLWDQILLERYGVQ 253

Query: 323 NPRSMMLRFHTQTAGSTLTAQQPENNIVRVAIQALAAVL---GGTQSLHTNSYDEALSLP 379
           +P++   R+  Q     LT QQPENN+ R+ I+ALA  L      ++L   +++EAL LP
Sbjct: 254 DPKARRFRYGVQVNSLGLTEQQPENNVYRILIEALAVTLSKDARCRALQLPAWNEALGLP 313

Query: 380 TEKSVRIALRTQQIIAYESGVVDTVDPLGGAYYIEWLTDHIYEEALKYIEKIQKMGGMMR 439
                + +LR QQ++AYE+ +++  D   G++ +E     + + AL  +  I +MGG   
Sbjct: 314 RPFDQQWSLRLQQVLAYETDLLEYEDLFDGSHVVEAKVAELSKGALAQLTLIDEMGGAQN 373

Query: 440 AIERGYVQKEIAEAAYKYQKEIEEGKRIIVGVNAFVTDE--PI---EVEILKVDPSIREK 494
           AI+  Y++ E+  +  K  + +E G+  +VGVN +   E  P+   E  I  VDP +   
Sbjct: 374 AID--YMKSELVASNAKRVRAVETGEMTVVGVNRWTETEASPLSAGESAIETVDPRLEAG 431

Query: 495 QIERLKKLRSERDNKKVQEALDKLRNAAEKEDENLMPYIIEAHRHLATLQEVTDVLREIW 554
            +ER+K  R  RD   V+ AL  L+ AA +E  N+M   I A +   T  E +  LRE++
Sbjct: 432 VVERIKAWREARDAVAVEAALAALK-AAAREGRNVMEPSIAAAKAGVTTGEWSGALREVF 490

Query: 555 GEYRAP 560
           GEYR P
Sbjct: 491 GEYRGP 496


Lambda     K      H
   0.318    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 809
Number of extensions: 42
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 563
Length of database: 662
Length adjustment: 37
Effective length of query: 526
Effective length of database: 625
Effective search space:   328750
Effective search space used:   328750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory