Align threonine ammonia-lyase (EC 4.3.1.19) (characterized)
to candidate CCNA_03203 CCNA_03203 threo-3-hydroxyaspartate ammonia-lyase
Query= BRENDA::Q74FW6 (402 letters) >FitnessBrowser__Caulo:CCNA_03203 Length = 325 Score = 202 bits (514), Expect = 1e-56 Identities = 125/307 (40%), Positives = 176/307 (57%), Gaps = 7/307 (2%) Query: 7 IQEADDRLRKRVRRTELIHSHHFSEKLGIPIYFKCENLQRTGAFKIRGALNFMTSQPREA 66 IQ A RL+ T LI S +++LG I+ K E LQR GAFK RGA N ++ E Sbjct: 8 IQAAAVRLKGSAVETPLIESPALNDRLGGRIFLKPETLQRAGAFKFRGAYNRLSQLSDEE 67 Query: 67 LAKGVITASAGNHAQGVAFSADLLGVPSTVFMPESTPPQKVFATRDYGAEVVLTGRNFDE 126 A+GV+ S+GNHAQGVA +A LLGVP+ + MP +P KV TR +GA++ R ++ Sbjct: 68 KARGVVAFSSGNHAQGVALAARLLGVPALIVMPSDSPSVKVEGTRGFGADIRFYDRFTED 127 Query: 127 AYAAAVQAQEERGALFVHPFDDPLVMAGQGTIGLEVLQEL----PDVANILVPIGGGGLI 182 A A Q ERG + V +DDP ++AGQGT+GLE++ + + ++ +GGGGLI Sbjct: 128 RVAIADQIAAERGCVVVPSYDDPHIIAGQGTVGLEIVAQAAAQGATLDRLICCVGGGGLI 187 Query: 183 AGIATAIRETHPHVRIIGVETAAAPSAHYSLQKGKIVQVPVTV-TLADGIAVKKPGVNTF 241 AG +TA++ P I GVE A SL+ G+ + ++ D + PG T+ Sbjct: 188 AGTSTAVKALSPATEIWGVEPAGFDETRRSLESGRRETIDKDARSICDALLTPIPGDLTW 247 Query: 242 PIIRDLVDEVVLVEEEEIALAIVALLERTKLLVEGAGAVPLAALLNRRVTDLSGKTVC-V 300 PI + + VV V + E+A A+ KL+VE G V L A L +V D++GKTV V Sbjct: 248 PINQKNLSGVVAVTDAEVAEAMRYAFSTLKLVVEPGGCVALTAALTGKV-DVAGKTVAIV 306 Query: 301 LSGGNID 307 LSGGN+D Sbjct: 307 LSGGNVD 313 Lambda K H 0.319 0.137 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 325 Length adjustment: 29 Effective length of query: 373 Effective length of database: 296 Effective search space: 110408 Effective search space used: 110408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory