Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate CCNA_03541 CCNA_03541 2,5-diketo-D-gluconic acid reductase
Query= SwissProt::O32210 (276 letters) >FitnessBrowser__Caulo:CCNA_03541 Length = 279 Score = 199 bits (506), Expect = 6e-56 Identities = 111/256 (43%), Positives = 156/256 (60%), Gaps = 3/256 (1%) Query: 15 VEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVAREEL 74 V MP G G +++ENG A V+ A++ GYR IDTA IY NE VG I+ SGV R+E+ Sbjct: 13 VLMPALGFGTWQLENGT-AVPLVEKALEIGYRHIDTAQIYGNERDVGAAIRNSGVKRDEI 71 Query: 75 FITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKD-KYKDTWRALEKLYKDG 133 F+T+KVW + + EKSLE+L +D +DL L+HWP + +T +AL + G Sbjct: 72 FLTTKVWIDQFADGDLQRSAEKSLEKLGVDQVDLLLLHWPKPEVPLAETLKALNAVRAKG 131 Query: 134 KIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLM 193 RAIG+SNF LEE K +E +QVE+HP L+ K L+ G+ + AWSPL Sbjct: 132 WTRAIGLSNFPSAQLEEAAKLSEAPIATDQVEYHPYLSLKTLKAKADQLGVSITAWSPLA 191 Query: 194 QGQLLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQE 253 QG++ + VL +I H K+ QV LRW +Q G++ IP++ RI EN DI DFELS++ Sbjct: 192 QGKVAQDPVLIEIGRAHGKTPGQVTLRWIIQQGIIAIPRTSNPKRIEENFDILDFELSEK 251 Query: 254 DMDKIDALNK-DERVG 268 +M +I L + D R+G Sbjct: 252 EMAQIHGLARPDGRIG 267 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 279 Length adjustment: 25 Effective length of query: 251 Effective length of database: 254 Effective search space: 63754 Effective search space used: 63754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory