Align predicted periplasmic 3-ketoglycoside hydrolase (DUF1080) (characterized)
to candidate CCNA_01698 CCNA_01698 endo-1,3-1,4-beta glucanase-related protein
Query= reanno::Pedo557:CA265_RS22975 (260 letters) >FitnessBrowser__Caulo:CCNA_01698 Length = 261 Score = 322 bits (825), Expect = 5e-93 Identities = 160/250 (64%), Positives = 181/250 (72%), Gaps = 8/250 (3%) Query: 11 ALFAGQAMAQDKKPDPAKDPKTTEVWEPVPKVVTPGKLPQDAPSDATILFGGRNLDAWHS 70 AL + A AQ + P+ TEVW+PVP VVTP P APSDA ILF GRNLD W + Sbjct: 17 ALLSATASAQTR-------PEDTEVWKPVPAVVTPASAPGGAPSDAIILFDGRNLDQWVT 69 Query: 71 VKDPSKPAEWTIDDGFFTVKKGTGNIETNKKFTDYQLHMEWKIPENISGEGQARGNSGVF 130 D S PA WT+ DG TV K GNIET + F DYQLH+EW+IP +I+G GQ RGNSGVF Sbjct: 70 AADKS-PAGWTVADGVITVDKARGNIETKRAFRDYQLHLEWRIPADIAGSGQGRGNSGVF 128 Query: 131 LASTGGGDNGYEIQIMDAYNNKTYVNGQTGSVYKQAIPLANANKKPGEWQYYDIIWNAPR 190 LASTG D GYE+QI+D+Y + TYVNGQ G+VYKQ PLANAN+KPGEWQ YDIIW AP Sbjct: 129 LASTGSRDQGYEVQILDSYQSATYVNGQAGAVYKQHPPLANANRKPGEWQTYDIIWRAPV 188 Query: 191 FNEDGTVQKPASVTVFLNGVLLQNGFVLKGETRYIGAPEYKKHGPSSIKLQDHGDPSPAI 250 F DG + PASVTV NGVL+Q+ VL GET YIG P YK HGPS IKLQ HGDPS I Sbjct: 189 FGSDGALTTPASVTVLHNGVLVQDNAVLAGETVYIGKPGYKAHGPSPIKLQAHGDPSIPI 248 Query: 251 SYRNIWVREL 260 S+RNIWVREL Sbjct: 249 SFRNIWVREL 258 Lambda K H 0.314 0.134 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 261 Length adjustment: 25 Effective length of query: 235 Effective length of database: 236 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory