Align Anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase component; EC 1.18.1.3 (characterized)
to candidate CCNA_03640 CCNA_03640 phenylpropionate dioxygenase ferredoxin reductase subunit
Query= SwissProt::Q84BZ0 (406 letters) >FitnessBrowser__Caulo:CCNA_03640 Length = 412 Score = 254 bits (648), Expect = 4e-72 Identities = 168/400 (42%), Positives = 215/400 (53%), Gaps = 6/400 (1%) Query: 7 VIVGAGHAARRTAEALRARDADAPIVMIGAERELPYDRPALSKDALLNDDGEQRAFVRDA 66 VIVGAGHA A LR + IV+IG E LPY RP LSK L + ++ A Sbjct: 12 VIVGAGHAGGSVAAFLRQYGHEGRIVLIGDEPLLPYQRPPLSKAWLKGEADADSLSLKPA 71 Query: 67 AWYDAQRIALRLGTRVDAIEREAQRVRLDDGTTLPYAKLVLATGSRVRTFG--GPIDAGV 124 WY + LRLG + I R + V L G +PY LVLATG+R R G AGV Sbjct: 72 GWYADNNVMLRLGGVAERINRSDKTVALASGEVIPYDFLVLATGARARELPIPGADLAGV 131 Query: 125 VAHYVRTVADARALRAQLVRGRRVAVLGGGFIGLEVAAAARQLGCNVTVIDPAARLLQRA 184 +A +RT ADA L+ L +R+AV+GGG++GLE AA+AR LG + VI+ +R+L R Sbjct: 132 LA--LRTAADAELLKNALGPDKRLAVVGGGYVGLEAAASARALGSHAMVIERESRVLARV 189 Query: 185 LPEVVGAYAHRLHDERGVGFQMATLPRAIRAAAGGGAIVETDRGDVHA-DVVVVGIGVLP 243 E + + H + GV F++ A G V + G V A DV +VG+G +P Sbjct: 190 ACETLSHFFQDYHGKHGVAFELNAGVAAFEGHDGHVTGVRFNDGRVVACDVALVGVGAVP 249 Query: 244 NVELAQAAGLDVDNGIRVDAGCRTADRAIFAAGEVTMHFNPLLGRHVRIESWQVAENQPA 303 N ELA+ AGL NG+ VD RT D +IFA G+VT PL R R+ES A Q Sbjct: 250 NDELAKDAGLSTANGVVVDLEARTDDPSIFAIGDVTHRPLPLYDRQFRLESVPNALEQAK 309 Query: 304 VAAANLLGADDAYAELPWLWSDQYDCNLQMLGLFGAGQTTVVRGDPARGPFTVFGLGGDG 363 AA+ +LG E PW WSDQYD LQ+ GL VVRGD A F VF L GD Sbjct: 310 QAASAILGRPGPAPETPWFWSDQYDLKLQIAGLPFDADRQVVRGDVAAAKFAVFHLKGD- 368 Query: 364 RIVAAAAVNLGRDIGAARRLIAAGAMPDPQQLADPTVGLK 403 + A AVN + A ++LIA D +LADP+V +K Sbjct: 369 LVQAVEAVNAPPEFMAGKQLIAKRTPVDANKLADPSVSMK 408 Lambda K H 0.322 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 412 Length adjustment: 31 Effective length of query: 375 Effective length of database: 381 Effective search space: 142875 Effective search space used: 142875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory