Align 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (characterized)
to candidate CCNA_02616 CCNA_02616 4-hydroxyphenylpyruvate dioxygenase
Query= reanno::psRCH2:GFF3449 (361 letters) >FitnessBrowser__Caulo:CCNA_02616 Length = 357 Score = 384 bits (985), Expect = e-111 Identities = 202/357 (56%), Positives = 251/357 (70%), Gaps = 7/357 (1%) Query: 7 IEQHNPIGTDGFEFVEFTAPNAEGIEQLRTLFTQMGFTETAKHRSKEVWLFQQHDINIVL 66 + NP+G DGFEFVEFT+P+ ++ L Q+GF +KH +K ++Q +N+++ Sbjct: 4 VTDQNPLGLDGFEFVEFTSPDPAA---MKALIEQLGFVAASKHPTKAATRYKQGRVNLIV 60 Query: 67 NGSPTGHVHAFAEKHGPSACAMAFRVKNAAQAAAYVESQGAKLVGSHANFGELNIPCVEG 126 N TG V F HGPSA MAFRV+NA QA A +GAK + + + +EG Sbjct: 61 NEETTGQVADFRADHGPSANGMAFRVENAEQAYADAVKRGAKPADASRSLLGADAKVLEG 120 Query: 127 IGGSLLYLVDRYGDK-SIYDVDFEYIEGRTPND--NAVGLMCIDHLTHNVMRGQMDVWSG 183 IGGSLLYLVDRYGD +IYD +E + G + N VGL +DHLTHNV RGQM WS Sbjct: 121 IGGSLLYLVDRYGDAGTIYDA-WEQVPGAALAEAKNNVGLDLLDHLTHNVKRGQMRTWST 179 Query: 184 FYERIANFREIRYFDIEGKLTGLFSRAMTAPCGKIRIPINESADDKSQIEEFIREYHGEG 243 FY +I F E +YFDI+G+ TGLFS+AM AP IRIP+NES DDKSQIEEFIR+Y+GEG Sbjct: 180 FYNQIFGFEEQKYFDIKGQATGLFSQAMIAPDKAIRIPLNESQDDKSQIEEFIRQYNGEG 239 Query: 244 IQHIALSTDDIYATVRQLRANGVDFMTTPDTYYEKVDTRVAGHGEPTDVLRELNILIDGA 303 IQH+A++TD+IY TV +LRA GV T +TYYE VD RV GHGE + LR+ ILIDGA Sbjct: 240 IQHLAMTTDNIYDTVEKLRARGVKLQDTIETYYELVDKRVPGHGEDLERLRKNRILIDGA 299 Query: 304 PGDDGILLQIFTNTVIGPIFFEIIQRKGNQGFGEGNFKALFESIEEDQLRRGVIKAD 360 G++G+LLQIFT + GPIFFEIIQRKGN+GFG GNF+ALFESIE DQ+RRGVI D Sbjct: 300 VGEEGLLLQIFTENLFGPIFFEIIQRKGNEGFGNGNFQALFESIELDQIRRGVITVD 356 Lambda K H 0.320 0.139 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 357 Length adjustment: 29 Effective length of query: 332 Effective length of database: 328 Effective search space: 108896 Effective search space used: 108896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate CCNA_02616 CCNA_02616 (4-hydroxyphenylpyruvate dioxygenase)
to HMM TIGR01263 (hppD: 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01263.hmm # target sequence database: /tmp/gapView.26399.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01263 [M=353] Accession: TIGR01263 Description: 4HPPD: 4-hydroxyphenylpyruvate dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-132 426.3 0.1 6.8e-132 426.2 0.1 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_02616 CCNA_02616 4-hydroxyphenylpyruva Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_02616 CCNA_02616 4-hydroxyphenylpyruvate dioxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 426.2 0.1 6.8e-132 6.8e-132 2 352 .. 14 352 .. 13 353 .. 0.98 Alignments for each domain: == domain 1 score: 426.2 bits; conditional E-value: 6.8e-132 TIGR01263 2 gfdfvefavgdakqaakalveklGfeavaketgsrekastvlrqgeitlvltaelsssseaaaflakHGdgvk 74 gf+fvef+++d+ a+kal+e+lGf a++k + +ka+t ++qg+++l++++e++ + +a+f a+HG++++ lcl|FitnessBrowser__Caulo:CCNA_02616 14 GFEFVEFTSPDPA-AMKALIEQLGFVAASK---HPTKAATRYKQGRVNLIVNEETTGQ--VADFRADHGPSAN 80 8************.*************999...*************************..************* PP TIGR01263 75 dvafevedveaafeaavergaeavsapeeedekevklaaikgiGdvvltlveregekgsilpgfeevsekaal 147 ++af+ve++e+a+++av+rga++++a+++ +++++++giG+++l+lv+r+g++g+i+++ e+v aal lcl|FitnessBrowser__Caulo:CCNA_02616 81 GMAFRVENAEQAYADAVKRGAKPADASRS--LLGADAKVLEGIGGSLLYLVDRYGDAGTIYDAWEQVPG-AAL 150 *************************9996..78999***************************887777.689 PP TIGR01263 148 kekledvgleaiDHvvgnvergelekvaefyekilgfkeiksfdikteasaLkSkvlasaegkvklplnepas 220 +e++++vgl+ +DH+++nv+rg+++++++fy++i+gf+e+k+fdik++a++L S+++ ++++++++plne s lcl|FitnessBrowser__Caulo:CCNA_02616 151 AEAKNNVGLDLLDHLTHNVKRGQMRTWSTFYNQIFGFEEQKYFDIKGQATGLFSQAMIAPDKAIRIPLNE--S 221 9999******************************************************************..9 PP TIGR01263 221 kkkksQIeeyleeyeGaGvQHlAlntedivktveelrargveflkipetYYdnlkervkklvkedleelkelk 293 +++ksQIee++++y+G+G+QHlA++t++i++tve+lrargv++ ++ etYY+ +++rv+ + edle+l++++ lcl|FitnessBrowser__Caulo:CCNA_02616 222 QDDKSQIEEFIRQYNGEGIQHLAMTTDNIYDTVEKLRARGVKLQDTIETYYELVDKRVPG-HGEDLERLRKNR 293 ***********************************************************7.************ PP TIGR01263 294 iLvDrd..eeGlLLQiFtkpvvdrgtlFfEiIqRkgakGFGegNfkaLfeaiEreqekrgv 352 iL+D++ eeGlLLQiFt++++ g++FfEiIqRkg++GFG+gNf+aLfe+iE +q++rgv lcl|FitnessBrowser__Caulo:CCNA_02616 294 ILIDGAvgEEGLLLQIFTENLF--GPIFFEIIQRKGNEGFGNGNFQALFESIELDQIRRGV 352 **********************..***********************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (353 nodes) Target sequences: 1 (357 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.06 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory