GapMind for catabolism of small carbon sources

 

Aligments for a candidate for atoB in Caulobacter crescentus NA1000

Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate CCNA_00820 CCNA_00820 3-ketoacyl-CoA thiolase

Query= BRENDA::Q0K368
         (391 letters)



>lcl|FitnessBrowser__Caulo:CCNA_00820 CCNA_00820 3-ketoacyl-CoA
           thiolase
          Length = 390

 Score =  612 bits (1578), Expect = e-180
 Identities = 302/391 (77%), Positives = 348/391 (89%), Gaps = 1/391 (0%)

Query: 1   MAEAYIVAAVRTAGGRKGGKLSGWHPADLAAQVLDALVERTGADPALVEDVIMGCVSQVG 60
           M EAYIVAA RTAGGRKGG++SGWHPADLA +VL+ALV+R+GADPAL+EDVIMGCV QVG
Sbjct: 1   MGEAYIVAAARTAGGRKGGRVSGWHPADLAGEVLNALVDRSGADPALIEDVIMGCVGQVG 60

Query: 61  EQAGNVARNAILASRLPESVPGTSVDRQCGSSQQALHFAAQAVMSGAMDIVIAAGVESMT 120
           EQA N+ARNA+LAS+LPESVP TSVDRQCGSSQQ++HFAA  VMSGAMDIVIAAGVESM+
Sbjct: 61  EQAINIARNAVLASKLPESVPATSVDRQCGSSQQSIHFAAATVMSGAMDIVIAAGVESMS 120

Query: 121 RVPMGLSSQLPAKNGFGVPKSPGIEARYPGVQFSQFTGAEMIARKYDLSREQLDAYALQS 180
           RVPMGLSS LP KNGFG  KSP +E RYPG+QFSQF GAEM+A+KYDLSREQLDA+AL S
Sbjct: 121 RVPMGLSSALPYKNGFGTYKSPRMEERYPGIQFSQFAGAEMLAKKYDLSREQLDAFALAS 180

Query: 181 HQRAIAATKSGRFTAEILPVEVRTADGANGEMHTTDEGVRYDATLESIGSVKLIAEGGRV 240
           HQRA+AATK G+F AEI+P++V   DG + E H  DEG+R+DAT+ESIG VKL++E GR+
Sbjct: 181 HQRAMAATKGGKFAAEIVPIKVTLPDG-SVETHDADEGIRWDATMESIGGVKLLSEDGRL 239

Query: 241 TAASASQICDGAAGLMVVNEAGLKKLGVKPLARVHAMTVIGHDPVVMLEAPLPATEVALK 300
           TAA++SQICDGAAG+M+VNE GLK LGV PLAR+H MTVIGHDPV+MLEAP+PAT+ AL+
Sbjct: 240 TAATSSQICDGAAGVMIVNERGLKALGVAPLARIHHMTVIGHDPVIMLEAPIPATQKALE 299

Query: 301 KAGLRIGDIDLFEVNEAFAPVPLAWLKATGADPARLNVHGGAIALGHPLGGSGAKLMTTL 360
           +AG++I DIDL+EVNEAFA VP AWL+ TG DP +LNV+GGAIALGHPLGGSGAKLMTTL
Sbjct: 300 RAGMKIDDIDLYEVNEAFASVPTAWLQVTGGDPDKLNVNGGAIALGHPLGGSGAKLMTTL 359

Query: 361 VHALHTHGKRYGLQTMCEGGGLANVTIVERL 391
           VHAL   G RYGLQTMCEGGGLANVTIVERL
Sbjct: 360 VHALKDRGARYGLQTMCEGGGLANVTIVERL 390


Lambda     K      H
   0.317    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 605
Number of extensions: 22
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 391
Length of database: 390
Length adjustment: 31
Effective length of query: 360
Effective length of database: 359
Effective search space:   129240
Effective search space used:   129240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory