Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate CCNA_03683 CCNA_03683 maleylpyruvate isomerase
Query= reanno::MR1:200836 (216 letters) >FitnessBrowser__Caulo:CCNA_03683 Length = 210 Score = 196 bits (499), Expect = 2e-55 Identities = 110/215 (51%), Positives = 139/215 (64%), Gaps = 9/215 (4%) Query: 1 MILYGYWRSSAAYRVRIALNLKGVSAEQLSVHLVRDGGEQHKAD-YIALNPQELVPTLVV 59 ++L+ R+SA YRVRI LNLKG++ E V LV + H+ + Y ALN Q LVPTL Sbjct: 3 LVLHSAKRASAPYRVRIGLNLKGLAFELRPVDLVANA---HQGEAYRALNAQALVPTL-- 57 Query: 60 DDEQDGDALTQSLAIIEYLDELYPKTPLLPASALERAHVRAMALTIACEIHPLNNLRVLQ 119 E DG LTQSLAI+E+LDE YP PLLP A +RA VRAMA IAC+IHPLNNLR+L+ Sbjct: 58 --EVDGRPLTQSLAILEWLDETYPAHPLLPTDAFDRATVRAMAEIIACDIHPLNNLRILR 115 Query: 120 YLTQKLTVNEEAKSAWYHHWVATGFTALETQLVRHSGRYCFGDKVTIADLCLVPQVYNAQ 179 LT L ++E A++AW W+ GF+ALE + RH Y FGD + D LVPQV+NA Sbjct: 116 QLT-ALEIDEPARNAWVARWIQDGFSALEPMIARHGQGYAFGDAPGLVDCLLVPQVFNAN 174 Query: 180 RFNVDLTPYPNIMRVWAECNQLPAFADAAPERQAD 214 RFNVDL+P+P + A PA A A P+ + Sbjct: 175 RFNVDLSPFPALEAAAAHARAHPAIAAAHPDHHPE 209 Lambda K H 0.321 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 210 Length adjustment: 22 Effective length of query: 194 Effective length of database: 188 Effective search space: 36472 Effective search space used: 36472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate CCNA_03683 CCNA_03683 (maleylpyruvate isomerase)
to HMM TIGR01262 (maiA: maleylacetoacetate isomerase (EC 5.2.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01262.hmm # target sequence database: /tmp/gapView.30274.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01262 [M=211] Accession: TIGR01262 Description: maiA: maleylacetoacetate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-76 242.3 0.0 2.2e-76 242.2 0.0 1.0 1 lcl|FitnessBrowser__Caulo:CCNA_03683 CCNA_03683 maleylpyruvate isomer Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Caulo:CCNA_03683 CCNA_03683 maleylpyruvate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 242.2 0.0 2.2e-76 2.2e-76 2 209 .. 5 209 .. 4 210 .] 0.97 Alignments for each domain: == domain 1 score: 242.2 bits; conditional E-value: 2.2e-76 TIGR01262 2 lYsyfrSsasyRvRiaLaLkgidyesvpvnLlkdGeqkkeefkalNPqelvPtLkidegevltqSlAiieyLe 74 l+s r+sa yRvRi+L+Lkg+++e +pv+L+++ +++ e+++alN q+lvPtL++d g+ ltqSlAi+e+L+ lcl|FitnessBrowser__Caulo:CCNA_03683 5 LHSAKRASAPYRVRIGLNLKGLAFELRPVDLVAN-AHQGEAYRALNAQALVPTLEVD-GRPLTQSLAILEWLD 75 5666799**************************6.999*******************.6************** PP TIGR01262 75 etypepaLlpkdpakrarvralalliacdihPlqNlrvlqlleeklgvdeeekkewlkhwiekGlaalEellk 147 etyp ++Llp+d+ +ra vra+a++iacdihPl+Nlr+l++l+ l++de ++++w+++wi++G++alE +++ lcl|FitnessBrowser__Caulo:CCNA_03683 76 ETYPAHPLLPTDAFDRATVRAMAEIIACDIHPLNNLRILRQLT-ALEIDEPARNAWVARWIQDGFSALEPMIA 147 *******************************************.568************************** PP TIGR01262 148 ekagafcvGdevtladvcLvpqvynAerfevdlaqyPtlkrieealaelpafqeahpenqpd 209 ++ + +++Gd+++l+d++Lvpqv nA+rf+vdl+++P+l++ +++++++pa+++ahp++ p+ lcl|FitnessBrowser__Caulo:CCNA_03683 148 RHGQGYAFGDAPGLVDCLLVPQVFNANRFNVDLSPFPALEAAAAHARAHPAIAAAHPDHHPE 209 99999*****************************************************9886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (210 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.63 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory