Align Probable 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (uncharacterized)
to candidate CCNA_01645 CCNA_01645 3-hydroxyisobutyrate dehydrogenase
Query= curated2:P63936 (294 letters) >FitnessBrowser__Caulo:CCNA_01645 Length = 286 Score = 150 bits (378), Expect = 4e-41 Identities = 95/271 (35%), Positives = 132/271 (48%), Gaps = 8/271 (2%) Query: 5 AFLGLGNMGAPMSANLVGAGHVVRGFDPAPTAASG-AAAHGVAVFRSAPEAVAEADVVIT 63 AF+G+G MG PM+ +L AGH V ++ +P A A HG A F + EAVA A+VV+ Sbjct: 4 AFIGMGVMGFPMAGHLKAAGHEVAVYNRSPEKARRWAEKHGGAAFETIAEAVAGAEVVLL 63 Query: 64 MLPTGEVVRRCYTDVLAAARPATLFIDSSTISVTDAREVHALAESHGMLQLDAPVSGGVK 123 + + VR VL A + +D +T S ARE+ ALA G +DAPVSGG Sbjct: 64 CVGNDDDVRDLVAQVLPAMGEGGVIVDHTTTSAKVAREMAALAAQSGRAFVDAPVSGGQA 123 Query: 124 GAAAATLAFMVGGDESTLRRARPVLEPMAGKIIHCGAAGAGQAAKVCNNMVLAVQQIAIA 183 GA + L M GGD++ R PV+E A + G GAGQ K+CN + +A +A Sbjct: 124 GAESGQLTIMAGGDQAAYDRVLPVIEVYAKAVRRIGEVGAGQLTKMCNQIAIAGVVQGVA 183 Query: 184 EAFVLAEKLGLSAQSLFDVITGATGNCWAVHTNCPVPGPVPTSPANNDFKPGFSTALMNK 243 EA A++ L + I+ W + P + A F GF+ M K Sbjct: 184 EALHFAKRACLPTDDVLAAISKGAAQSWQMENRWP-------TMAQGKFDFGFAVDWMRK 236 Query: 244 DLGLAMDAVAATGATAPLGSHAADIYAKFAA 274 DLG+A+D GA P + YA+ A Sbjct: 237 DLGIALDEARTNGAKLPATALIDQFYAEVQA 267 Lambda K H 0.319 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 286 Length adjustment: 26 Effective length of query: 268 Effective length of database: 260 Effective search space: 69680 Effective search space used: 69680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory