Align Putative xylitol transport system substrate-binding protein; SubName: Full=Sugar ABC transporter substrate-binding protein (characterized, see rationale)
to candidate CCNA_00902 CCNA_00902 inositol ABC transporter, periplasmic inositol-binding protein IbpA
Query= uniprot:A0A1N7UEK0 (335 letters) >FitnessBrowser__Caulo:CCNA_00902 Length = 326 Score = 106 bits (265), Expect = 7e-28 Identities = 89/278 (32%), Positives = 138/278 (49%), Gaps = 14/278 (5%) Query: 10 TAALSLLACSIAMAADGKTYKVGAAVYGLKGQFMQNWVRELKEHPAVKDGTVQLTVFDGN 69 TAAL L+ A G +V + L F REL++ A K G V++ V D Sbjct: 22 TAALGLMT---GCARGGAEAEVVVSFNDLSQPFFVAMRRELEDE-AAKLG-VKVQVLDAQ 76 Query: 70 YDALTQNNQIENMVTQRYDAILFVPIDTKAGVGTVKAAMSNDVVVIASNTKVADA--SVP 127 ++ Q + ++ Q ++ P D+KA G + V VI+ + +A +VP Sbjct: 77 NNSSKQISDLQAAAVQGAKVVIVAPTDSKALAGAADDLVEQGVAVISVDRNIAGGKTAVP 136 Query: 128 YVGNDDVEGGRLQAQAMVDKLNGKGNVVIIQGPIGQSAQIDREKGELEVLGKH-PDIKII 186 +VG D+V GGR A +V VV+I G S+ I+R KG + L P KI+ Sbjct: 137 HVGADNVAGGRAMADWVVKTYPAGARVVVITNDPGSSSSIERVKGVHDGLAAGGPAFKIV 196 Query: 187 EKKTANWDRAQALALTEDWLNAH---PKGINGVIAQNDDMALGAVQALKSHGLTSKDVPV 243 ++TAN R QAL +T++ L + P + ++ NDDMA+GA++A+++ GL S V V Sbjct: 197 TEQTANSKRDQALTVTQNILTSMRDTPPDV--ILCLNDDMAMGALEAVRAAGLDSAKVKV 254 Query: 244 TSIDGMPDAIQAAKKDE-VTTFLQDAQAQSQGALDVAL 280 D +P+A+ K E V T Q+ Q + AL A+ Sbjct: 255 IGFDAIPEALARIKAGEMVATVEQNPGLQIRTALRQAV 292 Lambda K H 0.314 0.130 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 326 Length adjustment: 28 Effective length of query: 307 Effective length of database: 298 Effective search space: 91486 Effective search space used: 91486 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory